DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and Best1

DIOPT Version :8

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_036043.2 Gene:Best1 / 24115 MGIID:1346332 Length:551 Species:Mus musculus

Alignment Length:564 Identity:198/565 (35%)
Similarity:293/565 (52%) Gaps:105/565 (19%)


  Fly     1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEA 65
            ||:|||::|:.:. |.:|..||:.||||||||::.:.:||..||..:...||::::.:.:..||.
Mouse     1 MTITYTNKVANAR-LGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEK 64

  Fly    66 IMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILISTSIHGSDDRARVMRRTIL 130
            :..||:....|||:||||||:|.:|::|||.||..:||||.:.|.:|:.:.|.|:..|::|||::
Mouse    65 LALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRLLRRTLI 129

  Fly   131 RYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIVWAASI 195
            ||..|.||::...||..|.:||||...::.|||:...|.|.::.:.....::   |:|.||.|::
Mouse   130 RYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTF---WVPWVWFANL 191

  Fly   196 VMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFSVLGQQ 260
            .|:|....:|||...::::::|:..||..||.|..|||||:|||||||||||.|||||..::|:|
Mouse   192 SMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQ 256

  Fly   261 WNESHSDEDGTRIRRWFPILTVLQFFFYMGWLKVAETLINPFGEDDDDFELNWIIDRNLTVSYCI 325
            :...:.|..|..:....|:.|:|||.||||||||||.|||||||||||||.||||||||.||...
Mouse   257 FLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLS 321

  Fly   326 VDEMHQEHPELVKDQYWEEVFPNEIPY--AQPKMRQNPPAAST-----------AYMESQSKLQK 377
            ||.|||..|.:.:|.||.|..| :.||  |..:.|::....||           .:.:.::...|
Mouse   322 VDGMHQNLPPMERDMYWNEAAP-QPPYTAASARSRRHSFMGSTFNISLKKEDLELWSKEEADTDK 385

  Fly   378 RHESAMSTLSTRSRNNFRQNFLG---------------------RPSATGSYSDSIQMEDGPSRV 421
            :.....||:..         |||                     .|...|...|:.|        
Mouse   386 KESGYSSTIGC---------FLGLQPKNYHLPLKDLKTKLLCSKNPLLEGQCKDANQ-------- 433

  Fly   422 TFSENQFDL-------------------PH--DEANSSHKPSQS-----------TIDFNDLIEQ 454
               :||.|:                   .|  .:|.|||...||           :.|:.::...
Mouse   434 ---KNQKDVWKFKGLDFLKCVPRFKRRGSHCGPQAPSSHPTEQSAPSSSDTGDGPSTDYQEICHM 495

  Fly   455 RRR----------ERRERIRHRFLDMQSTH----LRHDTSGAPY 484
            :::          ...|.::.|.||..||:    ::......||
Mouse   496 KKKTVEFNLNIPESPTEHLQQRRLDQMSTNIQALMKEHAESYPY 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411 144/311 (46%)
Best1NP_036043.2 Bestrophin 8..315 CDD:279411 144/311 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62975732
eggNOG 1 0.900 E1_KOG3547
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1942
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D145964at33208
OrthoFinder 1 1.000 FOG0000272
OrthoInspector 1 1.000 T130816
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10736
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.