powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG6878 and Romo1
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_648757.1 | 
            Gene: | CG6878 / 39656 | 
            FlyBaseID: | FBgn0036488 | 
            Length: | 79 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001157688.1 | 
            Gene: | Romo1 / 67067 | 
            MGIID: | 1914317 | 
            Length: | 79 | 
            Species: | Mus musculus | 
          
        
        
        
          
            | Alignment Length: | 79 | 
            Identity: | 49/79 - (62%) | 
          
          
            | Similarity: | 62/79 -  (78%) | 
            Gaps: | 0/79 - (0%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     1 MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGG 65 
            ||:....:.|..|:|||::|.||::|..||||:||:||.||.||.|:|||||:..:||||:|.|| 
Mouse     1 MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGG 65 
 
  Fly    66 TFGTFMAIGTGIRC 79 
            |||||||||.|||| 
Mouse    66 TFGTFMAIGMGIRC 79 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
      
           
             Return to query results.
             Submit another query.