DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and Romo1

DIOPT Version :8

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001157688.1 Gene:Romo1 / 67067 MGIID:1914317 Length:79 Species:Mus musculus

Alignment Length:79 Identity:49/80 (61%)
Similarity:62/80 (78%) Gaps:0/80 (0%)


  Fly     1 MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGG 65
            ||:....:.|..|:|||::|.||::|..||||:||:||.||.||.|:|||||:..:||||:|.||
Mouse     1 MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGG 65

  Fly    66 TFGTFMAIGTGIRC 79
            |||||||||.||||
Mouse    66 TFGTFMAIGMGIRC 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:287249 44/65 (68%)
Romo1NP_001157688.1 Romo1 14..79 CDD:313473 44/65 (68%)
Sufficient for antibacterial activity. {ECO:0000250} 42..60 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4096
Hieranoid 1 1.000
Homologene 1 1.000 H7096
Inparanoid 1 1.050 112 1.000 Inparanoid score I4820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002485
OrthoInspector 1 1.000 T1085016
orthoMCL 1 0.900 OOG5_130528
Panther 1 1.100 LDO PTHR28525
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R715
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.