DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and mgr2

DIOPT Version :8

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_595661.1 Gene:mgr2 / 2540425 PomBaseID:SPBC27.06c Length:120 Species:Schizosaccharomyces pombe

Alignment Length:66 Identity:28/67 (42%)
Similarity:40/67 (60%) Gaps:0/67 (0%)


  Fly    13 PTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGTFMAIGTGI 77
            |:..||:|.|.|:|...|:..|.:|||.:.||||...|..:..:|:.|:....|||.||:||:.|
pombe     6 PSTVDKLKMGAIMGSAAGLGIGFLFGGVAVLRYGPGPRGFLRTLGQYMLTSAATFGFFMSIGSVI 70

  Fly    78 R 78
            |
pombe    71 R 71

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:287249 27/66 (41%)
mgr2NP_595661.1 Romo1 7..71 CDD:287249 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I1976
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002485
OrthoInspector 1 1.000 T1125688
orthoMCL 1 0.900 OOG5_130528
Panther 1 1.100 LDO PTHR28525
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R715
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.