DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pdi and tmx3

Sequence 1:NP_001287070.1 Gene:Pdi FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_002939661.1 Gene:tmx3 XenbaseID:XB-GENE-946768 Length:454 Species:Xenopus tropicalis

Alignment Length:362 Identity:89/363 (25%)
Similarity:165/363 (45%) Gaps:48/363 (13%)


  Fly     9 FLAASYVAASAEAEVKVEEGVLVATV-DNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQ 72
            |:.|:..:.|..|.:.|  ..||..: |:||:...| :..||:||||||||||.|.|.:.:...:
 Frog     8 FILATVASTSLLASLPV--SALVEDLDDSFKENRKD-DIWLVDFYAPWCGHCKKLEPVWNEVGIE 69

  Fly    73 LAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPA 137
            :....|||::.|:||||...:|.::.|||:||:|..:......|.|.|...||:.:..:..||..
 Frog    70 MRSSGSPIRVGKMDATVHSSIASEFGVRGFPTIKVLKGDMAYNYRGPRTKEDIVEFANRVAGPLI 134

  Fly   138 KDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEA---- 198
            :.|.|....:...|.:.:..:  :..:||...:.:.:||:.|..:.:..||:.||:.||..    
 Frog   135 RPLPSQQMFDHVQKRHSVLFV--YVGVESTLKEKYIEVASELIVYTYFFSSSEDVLPKYVTLNEV 197

  Fly   199 ------KDNGVVLFKPFDDKKSVFEGEL----NEENLKKFAQVQSLPLIVDFNHESASKIFGGSI 253
                  ||:...::..::|      |:|    |:|..:.:..:....|     :|     .|.:.
 Frog   198 PAVLVFKDSTYFVYDEYED------GDLSSWVNKERFEGYLHIDGFTL-----YE-----LGDTG 246

  Fly   254 KSHLLFFVSREGGHIE--KYVDPLKEIAKKYRD----DILFVTISSDEEDHTRIFEFFGMNKEEV 312
            |...:..:..:...:|  :.....:::||.|||    |..|..:..::..::.:     |::..:
 Frog   247 KLVAVAVIDEKNNSVEHTRLKSIAQDVAKNYRDHFHRDFQFGHMDGNDYINSLL-----MDELSI 306

  Fly   313 PTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDG 349
            ||..::. ..:...:.|.....:.|.:..|:...|||
 Frog   307 PTFVVLN-TSNQQYFLPSKQIENTEEMIQFINSILDG 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 84/345 (24%)
pdi_dom 33..133 CDD:273454 38/101 (38%)
PDI_b_family 137..231 CDD:239279 21/108 (19%)
PDI_b'_family 244..347 CDD:239280 16/109 (15%)
PDI_a_PDI_a'_C 368..469 CDD:239293
tmx3XP_002939661.1 PDI_a_TMX3 27..130 CDD:239298 40/104 (38%)
Thioredoxin_6 160..337 CDD:290560 36/199 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91071944
eggNOG 1 0.900 E1_COG0526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.