DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12316 and Msl1

Sequence 1:NP_648752.1 Gene:CG12316 FlyBaseID:FBgn0036483 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_082998.2 Gene:Msl1 MGIID:1921276 Length:616 Species:Mus musculus

Alignment Length:713 Identity:126/714 (18%)
Similarity:213/714 (30%) Gaps:241/714 (34%)


  Fly   487 QTLDDEEQDLV--EEDQYSGAHSHGFFPRSSN--------ASYASGQRTP-------------LY 528
            |.||.|....:  .||:...|.:| |.||...        ||...|..:|             |.
Mouse    21 QRLDYERAAALGGPEDESGAAEAH-FLPRHRKLKEPGPPLASSQGGSPSPSPAGCGGGKGRGLLL 84

  Fly   529 HCRQTSSQNSNCSESSL-------LKKQVTFSPRHLGAATPNAKTGTSKKPSIKQYKPSSSNATE 586
            .......|.......|:       ..||.     .:|.....|..|.|.:|..:...|..:.:..
Mouse    85 PAGAAPGQQEESWGGSVPLPCPPPATKQA-----GIGGEPVAAGAGCSPRPKYQAVLPIQTGSIV 144

  Fly   587 SQRWKEEHRKASAKMFAKLDAKIKARSEAENVSTSQLTPTTSNASSSTPTKISGTPTRIRSTQRG 651
            ....||....|..|..|...|                 .|.|:.:...|..:.|.|.        
Mouse   145 VAAAKEPTPWAGDKGGAAPPA-----------------ATASDPAGPPPLPLPGPPP-------- 184

  Fly   652 QRVALPTPPASTHSSSSP--CQIRSASTDNHNYNVDSDYSRRCFSKAAGDEVSYYNHLLTLQREN 714
               ..||..|.|.::|..  ..||.:......            ...|..:.:....:|.||.:.
Mouse   185 ---LAPTATAGTLAASEGRWKSIRKSPLGGGG------------GSGASSQAACLKQILLLQLDL 234

  Fly   715 IRRRRLNNQKKKKNRKVSQKVQKKDDKLNMLKQATKRCRKLRALNAKRK---------------- 763
            |.:::  .|.:.|.:::.:...::|..|..:::..:|.:.::..|.|.:                
Mouse   235 IEQQQ--QQLQAKEKEIEELKSERDTLLARIERMERRMQLVKRDNEKERHKLLQGYEPEEREEAE 297

  Fly   764 -NEVQKLEQDLDTIRKS-------------------------APHKLPIIRL----KRCNLKTQK 798
             :|..|||:..:....|                         ...|.|:.:|    .:...||.|
Mouse   298 LSEKIKLERQPELCETSQALPSKPFSCGRSGKGHKRKTPFGNTERKTPVKKLAPEFSKVKTKTPK 362

  Fly   799 RS-LKAEEAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQENEKYLREQEIIISQSQMV 862
            .| :|.|...|:.|.:..    |||:.|:..:||:..                    :.:..::.
Mouse   363 HSPIKEEPCGSISETVCK----RELRSQETPEKPRSS--------------------VDTPPRLS 403

  Fly   863 EEDKVEEHHAHEAPSEQQRELDLEHQQFLE--EQLLQEEHQ-----LAMHEEEHHQMDDEQESHE 920
            ...|....|    |.|:....::|...:|.  |..|...||     |.:.|      ...::...
Mouse   404 TPQKGPSTH----PKEKAFSSEMEDLPYLSTTEMYLCRWHQPPPSPLPLRE------SSPKKEET 458

  Fly   921 VARLLEDQQPAEGTHLHVENEMLAEKEQPLIEDDDQEADDQNQNEHLSDDQQQEADQQLSIEQPQ 985
            |||.|.....|..|.:...........:||     ::.:..:..|:|.|....:...:|.:::  
Mouse   459 VARCLMPSSVAGETSVLAVPSWRDHSVEPL-----RDPNPSDILENLDDSVFSKRHAKLELDE-- 516

  Fly   986 EHEENQSLSQDPLDEQCTPTPNGKRRK-------RRRRFKRRCWTHVKNKKKKQWLIDYPLEFEA 1043
                                   ||||       |.:|..:|....:..||..|         |:
Mouse   517 -----------------------KRRKRWDIQRIREQRILQRLQLRMYKKKGIQ---------ES 549

  Fly  1044 DPALDTPPIQPEPAPDEQQAELVTGPVSESVAEPVAEPVAEPVSEPFAEQIAEPIAQPTPEPA 1106
            :|  :.....||  ||:.::.|:|                     ||...:|  ..:|.|:.|
Mouse   550 EP--EVTSFFPE--PDDVESLLIT---------------------PFLPVVA--FGRPLPKLA 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12316NP_648752.1 PHA02666 504..>685 CDD:222914 38/211 (18%)
GBP_C <819..947 CDD:303769 24/135 (18%)
coiled coil 931..943 CDD:293879 2/12 (17%)
Trypan_PARP <1026..1130 CDD:114603 17/82 (21%)
Msl1NP_082998.2 Interaction with MSL2. {ECO:0000250} 225..239 4/14 (29%)
PEHE 477..593 CDD:291924 30/176 (17%)
Interaction with KAT8. {ECO:0000269|PubMed:21217699} 500..520 6/45 (13%)
Interaction with MSL3 MRG domain 552..593 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C132177571
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.