| Sequence 1: | NP_648752.1 | Gene: | CG12316 / 39650 | FlyBaseID: | FBgn0036483 | Length: | 1188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021336014.1 | Gene: | msl1b / 563262 | ZFINID: | ZDB-GENE-030131-4491 | Length: | 529 | Species: | Danio rerio |
| Alignment Length: | 614 | Identity: | 123/614 - (20%) |
|---|---|---|---|
| Similarity: | 220/614 - (35%) | Gaps: | 172/614 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 541 SESSLLKKQVTFSP---RHLGAATPNAKTGTSKKP-SIKQYKPSSSNATESQRWKEEHRKASAKM 601
Fly 602 FAKLDAKIKARSEAENVSTSQLTPTTSNASSSTPTKISGTPTRIRS-TQRGQRVALPTPP----A 661
Fly 662 STH-SSSSPCQIRSASTDNHNYNVDSDYSRRCFSKAAGD---EVSYYNHLLTLQRENIRRRRLNN 722
Fly 723 QKKKKNRKVSQKVQKKDDKLNMLKQATKRCRKLRALNAKRKNE--VQKLEQ---DLDTIRKSAPH 782
Fly 783 KLPIIRLKRCNLKTQKRSLKAEEAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQEN-- 845
Fly 846 ----EKYLREQEIIISQSQMVEEDKVEEHHAHEAPSEQQRELDLEHQQFLEEQLLQEEHQLAMHE 906
Fly 907 EEHHQMDDE---QESHEVARLLEDQQPA----EGTHLHV----------ENEMLAEKEQPLIEDD 954
Fly 955 DQEADDQNQNEHLSDDQQQEADQQLSIEQPQEHEENQSLSQDPLDEQCTPTPNGKRRK------- 1012
Fly 1013 RRRRFKRRCWTHVKNKKKKQWLIDYPLEFEADPALDTPPIQPEPAPDEQQAELVTGPVSESVAEP 1077
Fly 1078 VAEPVAEPVSEPFAEQIA--EPIAQPTPE 1104 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12316 | NP_648752.1 | PHA02666 | 504..>685 | CDD:222914 | 34/153 (22%) |
| GBP_C | <819..947 | CDD:303769 | 26/150 (17%) | ||
| coiled coil | 931..943 | CDD:293879 | 5/25 (20%) | ||
| Trypan_PARP | <1026..1130 | CDD:114603 | 15/81 (19%) | ||
| msl1b | XP_021336014.1 | PEHE | 388..506 | CDD:317651 | 35/180 (19%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170578061 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR21656 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||