DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12316 and msl1b

Sequence 1:NP_648752.1 Gene:CG12316 FlyBaseID:FBgn0036483 Length:1188 Species:Drosophila melanogaster
Sequence 2:XP_021336014.1 Gene:msl1b ZFINID:ZDB-GENE-030131-4491 Length:529 Species:Danio rerio

Alignment Length:614 Identity:123/615 (20%)
Similarity:220/615 (36%) Gaps:172/615 (28%)


  Fly   541 SESSLLKKQVTFSP---RHLGAATPNAKTGTSKKP-SIKQYKPSSSNATESQRWKEEHRKASAKM 601
            |::.|..|:..|||   ||..:|....:......| ..:::..|..|...            |.:
Zfish     9 SKAGLYSKKCDFSPSQTRHPVSAQRELRDPLCDTPDDTREHLISQKNLER------------ASL 61

  Fly   602 FAKLDAKIKARSEAENVSTSQLTPTTSNASSSTPTKISGTPTRIRS-TQRGQRVALPTPP----A 661
            .:|...::...|||.:|.|..|        ||...::.|..|.::| |..||..|:...|    .
Zfish    62 PSKPGRELIVASEAGSVGTETL--------SSQAKQMGGEGTPVKSKTPFGQTNAIDNKPEFVSM 118

  Fly   662 STH-SSSSPCQIRSASTDNHNYNVDSDYSRRCFSKAAGD---EVSYYNHLLTLQRENIRRRRLNN 722
            ::| :|..|...::|.....:.:..|:..|....|.:|:   :.:....||.||.:.|.:::  .
Zfish   119 NSHINSRDPVGEKNAKETMGSSHEHSEGKRTNMKKISGNPHAQATCLKQLLLLQLDLIEQQQ--Q 181

  Fly   723 QKKKKNRKVSQKVQKKDDKLNMLKQATKRCRKLRALNAKRKNE--VQKLEQ---DLDTIRKSAPH 782
            |.:.|::::.   :.|.|:..:|.:..:..|:|:.|:.:.:::  .|.||:   |.|...:|...
Zfish   182 QLQSKDKEID---ELKSDRDTLLARIERMERRLQLLSKEPRDKRLFQPLERWVPDTDDFWESDLG 243

  Fly   783 KLPIIRLKRCNLKTQKRSLKAEEAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQEN-- 845
            ..|..:..:.:.|.|||.|.|.|.                    |.|:.:.|..:...::.:.  
Zfish   244 DSPQTQASKSSGKVQKRKLSATET--------------------KTQRSRGKSSRTTPQKSDTRG 288

  Fly   846 ----EKYLREQEIIISQSQMVEEDKVEEHHAHEAPSEQQRELDLEHQQFLEEQLLQEEHQLAMHE 906
                ::.||.:|.....|......|.:: ||.|..|::..||         ..:...|..|...|
Zfish   289 PSPCQRELRSKETPEKASTGKSSRKTDQ-HAEEGSSKEADEL---------PYMTTTEMYLCCWE 343

  Fly   907 EEHHQMDDE---QESHEVARLLEDQQPA----EGTHLHV----------ENEMLAEKEQPLIEDD 954
            .....:.::   :|....::.|...|.|    ..|:.:|          ||.|     :||.|:|
Zfish   344 PPDSSLQEDCPKKEEDVASKFLVQIQNALFKRWFTNCYVKTIFPVPSWRENIM-----EPLKEED 403

  Fly   955 DQEADDQNQNEHLSDDQQQEADQQLSIEQPQEHEENQSLSQDPLDEQCTPTPNGKRRK------- 1012
                         :.|..:..|..:.:::..:.|         |||        ||||       
Zfish   404 -------------AADLPESLDDSVFLKRHAKLE---------LDE--------KRRKRWDIQRI 438

  Fly  1013 RRRRFKRRCWTHVKNKKKKQWLIDYPLEFEADPALDTPPIQPEPAPDEQQAELVTGPVSESVAEP 1077
            |.:|..:|....::.||                    |.:..|..|:            .|...|
Zfish   439 REQRMLQRLQQRMEKKK--------------------PNVVQESEPE------------VSSFHP 471

  Fly  1078 VAEPVAEPVSEPFAEQIA--EPIAQPTPE 1104
            ..|.|...:..||...:|  .|:...||:
Zfish   472 DLENVEAIMVTPFLPVVAFGRPLPNLTPQ 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12316NP_648752.1 PHA02666 504..>685 CDD:222914 34/154 (22%)
GBP_C <819..947 CDD:303769 26/151 (17%)
coiled coil 931..943 CDD:293879 6/26 (23%)
Trypan_PARP <1026..1130 CDD:114603 15/82 (18%)
msl1bXP_021336014.1 PEHE 388..506 CDD:317651 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C132169806
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.