DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12316 and msl-1

Sequence 1:NP_648752.1 Gene:CG12316 FlyBaseID:FBgn0036483 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_001286054.1 Gene:msl-1 FlyBaseID:FBgn0005617 Length:1039 Species:Drosophila melanogaster

Alignment Length:555 Identity:117/556 (21%)
Similarity:210/556 (38%) Gaps:151/556 (27%)


  Fly   708 LTLQRENIRRR-RLN-NQKKKKNRKVSQKVQKKDD---KLNM-------LKQATKR--------C 752
            |..:..|:||. .|| |..:::...::.|.::.||   |:::       ||||..:        |
  Fly   103 LISENNNLRRMVMLNLNLMQEQTDSIAAKDKELDDQSAKMSVVKAQNEELKQAVAQLEAANQELC 167

  Fly   753 RKLRALNAKRKNEVQKLEQDLDTIRKSAPHKLPIIRLKRCNLKTQ-------------------- 797
            ::||..|.:|.      :.|.|......|...|..:|.||:.:||                    
  Fly   168 KQLRRKNQRRN------DNDDDDDDPPLPPAAPQQKLIRCHAETQTVFREREQGTQTIDAQPQFA 226

  Fly   798 ---KRSLKAEEAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQENEKYLREQEIIISQS 859
               .|.:..:|:|::.....::.:           :|..||.:...:.:.|.|  :....|:   
  Fly   227 NALPRGINMKESPALDHHAGAVTN-----------QPASKRSESKGRGEFNGK--KVSTFIL--- 275

  Fly   860 QMVEEDKVEEHHAHEAPSEQQRELDLEHQ-QFLEEQLLQEEHQLAMHEEEHHQMDDEQESHEVAR 923
            |.:.:|  .|||.||     |.|:..||: :..:||:.|||.||...|:..|..:...|......
  Fly   276 QRMNQD--FEHHIHE-----QTEVAEEHEMEAHKEQISQEEDQLVAEEDHLHMQEVHTEEVVGGD 333

  Fly   924 LLEDQQPAEGTHLHVENEMLAEKEQ--------PLIEDDDQEADDQNQNEHLSDDQQQ------- 973
            :..|  ..|...:.|..|.|.:.|:        ..||:||.|.|:.::|....||.::       
  Fly   334 IFHD--ALESIEMEVVTEELVDMEEHGQSVDANGHIEEDDDEDDEDDENSDKDDDSEEDDYPWMH 396

  Fly   974 -EADQQLSIEQPQEHEENQSLSQDPLDEQ-CTP----TPNGKRRKRRRRFKRRCWTHVKNKKKKQ 1032
             :||.....|:.....:|..|..||.:|: |.|    |||.:::...:       ..::.:..:.
  Fly   397 SDADVNARTEEELWQNQNYLLELDPTEEKTCAPSAHSTPNHQQKSSTQ-------AEIRKEGNQN 454

  Fly  1033 WLIDYPLEFEADPALDT--PPIQPEPAPDEQQAELVTGPVSESVAEPVAEPVAEPVSEPFAE--- 1092
            .:.:..|:.:.:|.:|.  .||.|         :.|.....:...|.|.|....|..:|..|   
  Fly   455 RITEKLLQLKPEPMVDALEAPILP---------KWVAFKKKDKEHESVPESPEVPKQQPHQEDAI 510

  Fly  1093 ----------QIAEPIAQPTPEPAYDFDQDLVPEVGNELEIAAPIRVAEDEDSTAIL-------- 1139
                      ::.:|..:|..:|..:..||      .:|:    :||...||...:.        
  Fly   511 VDHNAIKNQLEVPKPDLKPKDQPKDEQRQD------GQLD----VRVEPQEDVRKVQKETLKRQP 565

  Fly  1140 --SPSHNLELVTSHVPVYLLNGESRDVSTPLSSSS 1172
              :|.|..:.|...|    ....||:.:.|.::::
  Fly   566 EDAPKHLPKAVAPKV----TKTSSRESTLPKANTA 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12316NP_648752.1 PHA02666 504..>685 CDD:222914
GBP_C <819..947 CDD:303769 32/129 (25%)
coiled coil 931..943 CDD:293879 3/12 (25%)
Trypan_PARP <1026..1130 CDD:114603 21/119 (18%)
msl-1NP_001286054.1 PEHE 867..983 CDD:291924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131564776
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21656
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.