DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12316 and MSL1

Sequence 1:NP_648752.1 Gene:CG12316 FlyBaseID:FBgn0036483 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_001352848.1 Gene:MSL1 HGNCID:27905 Length:614 Species:Homo sapiens

Alignment Length:726 Identity:123/727 (17%)
Similarity:216/727 (30%) Gaps:269/727 (37%)


  Fly   487 QTLDDEEQDLV--EEDQYSGAHSHGFFPRSSN--------ASYASGQRTP------------LYH 529
            |.||.|....:  .||:...|.:| |.||...        ||...|...|            |..
Human    21 QRLDYERAAALGGPEDEPGAAEAH-FLPRHRKLKEPGPPLASSQGGSPAPSPAGCGGKGRGLLLP 84

  Fly   530 CRQTSSQNSN---------CSESSLLKKQVTFSPRHLGAATPNAKTGTSKKPSIKQYKPSSSN-- 583
            ......|...         |...:..:..:...|...||       |.|.:|..:...|..:.  
Human    85 AGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAAAGA-------GCSPRPKYQAVLPIQTGSL 142

  Fly   584 ---ATESQRWKEEHRKASAKMFAKLDAKIKARSEAENVSTSQLTPTTSNASSSTPTKISGTPTRI 645
               |.|...|..:...|::.                       ..|.|:.:...|..:.|.|.  
Human   143 VAAAKEPTPWAGDKGGAASP-----------------------AATASDPAGPPPLPLPGPPP-- 182

  Fly   646 RSTQRGQRVALPTPPASTHSSS---------SPCQIRSASTDNHNYNVDSDYSRRCFSKAAGDEV 701
                     ..||..|.|.::|         ||......|                   .|..:.
Human   183 ---------LAPTATAGTLAASEGRWKSMRKSPLGGGGGS-------------------GASSQA 219

  Fly   702 SYYNHLLTLQRENIRRRRLNNQKKKKNRKVSQKVQKKDDKLNMLKQATKRCRKLRALNAKRKNEV 766
            :....:|.||.:.|.:::  .|.:.|.:::.:...::|..|..:::..:|.:.::..|.|.::::
Human   220 ACLKQILLLQLDLIEQQQ--QQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKL 282

  Fly   767 -----------------------QKLEQDLDTI---------------RK----SAPHKLPIIRL 789
                                   .:|.:...|:               ||    |...|.|:.:|
Human   283 FQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKL 347

  Fly   790 ----KRCNLKTQKRS-LKAEEAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQENEKYL 849
                .:...||.|.| :|.|...|:.|.:..    |||:.|:..:||:..               
Human   348 APEFSKVKTKTPKHSPIKEEPCGSLSETVCK----RELRSQETPEKPRSS--------------- 393

  Fly   850 REQEIIISQSQMVEEDKVEEHHAHEAPSEQQRELDLEHQQFLE--EQLLQEEHQ-----LAMHEE 907
                 :.:..::....|....|    |.|:....::|...:|.  |..|...||     |.:.| 
Human   394 -----VDTPPRLSTPQKGPSTH----PKEKAFSSEIEDLPYLSTTEMYLCRWHQPPPSPLPLRE- 448

  Fly   908 EHHQMDDEQESHEVARLLEDQQPAEGTHLHVENEMLAEKEQPLIEDDDQEADDQNQNEHLSDDQQ 972
                 ...::...|||.|.....|..|.:...........:||     ::.:..:..|:|.|...
Human   449 -----SSPKKEETVARCLMPSSVAGETSVLAVPSWRDHSVEPL-----RDPNPSDLLENLDDSVF 503

  Fly   973 QEADQQLSIEQPQEHEENQSLSQDPLDEQCTPTPNGKRRK-------RRRRFKRRCWTHVKNKKK 1030
            .:...:|.:::                         ||||       |.:|..:|....:..||.
Human   504 SKRHAKLELDE-------------------------KRRKRWDIQRIREQRILQRLQLRMYKKKG 543

  Fly  1031 KQWLIDYPLEFEADPALDTPPIQPEPAPDEQQAELVTGPVSESVAEPVAEPVAEPVSEPFAEQIA 1095
            .|         |::|  :.....||  ||:.::.::|                     ||...:|
Human   544 IQ---------ESEP--EVTSFFPE--PDDVESLMIT---------------------PFLPVVA 574

  Fly  1096 --EPIAQPTPE 1104
              .|:.:.||:
Human   575 FGRPLPKLTPQ 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12316NP_648752.1 PHA02666 504..>685 CDD:222914 36/224 (16%)
GBP_C <819..947 CDD:303769 24/135 (18%)
coiled coil 931..943 CDD:293879 2/12 (17%)
Trypan_PARP <1026..1130 CDD:114603 16/82 (20%)
MSL1NP_001352848.1 Interaction with MSL2 223..237 4/14 (29%)
TOP2c <243..429 CDD:330395 34/214 (16%)
PEHE 475..591 CDD:317651 29/176 (16%)
Interaction with KAT8 498..518 6/45 (13%)
Sufficient for interaction with MSL3 MRG domain 550..591 11/60 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C132165438
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.