DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12316 and msl1a

Sequence 1:NP_648752.1 Gene:CG12316 FlyBaseID:FBgn0036483 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_001107940.1 Gene:msl1a ZFINID:ZDB-GENE-030131-8168 Length:489 Species:Danio rerio

Alignment Length:496 Identity:87/497 (18%)
Similarity:170/497 (34%) Gaps:145/497 (29%)


  Fly   580 SSSNATESQRWKEEHR--KASAKMFAKLDAKIKARS---EAENVSTSQLTPTTSNASSSTPTKIS 639
            ||:.....:.|:....  ..|.|......:.:|:||   :..:.....:.|..||.::       
Zfish    76 SSAGGLGHKNWEPSGALILPSTKQMGAEGSPVKSRSLFCQTNHNHLVNMDPMVSNDNN------- 133

  Fly   640 GTPTRIRSTQRGQRVALPTPPASTHSSSSPCQIRSASTDNHNYNVDSDYSRRCFSKAAGDEVSYY 704
                   ..:.|::|......:|...|.|          ..::||      |..|.....:.|..
Zfish   134 -------QQREGEQVGAMVGDSSPEDSPS----------GKHWNV------RKGSGLVDPQTSCI 175

  Fly   705 NHLLTLQRENI--RRRRLNNQKKK------KNRKVSQKVQKKDDKLNMLKQ-------ATKRCRK 754
            ..:|.||.|.|  :::.|:|:.|:      :...:..::::.:.:|.|:|:       :...|.|
Zfish   176 RQILLLQLELIEQQQKHLHNKNKEIEDLKAEKEMLMARIERMEHRLQMVKKDGVVSRPSQTTCHK 240

  Fly   755 LRALNAKRKNEVQ----KLEQDLDTIR----KSAPHKL-----PIIRLKRCNLKTQKRS--LKAE 804
            .........::||    :::....|.|    |.:..|.     |..|.:|    .|.||  ...:
Zfish   241 EPEAETTTSDDVQHSGGRVQTPKQTQRGRGVKGSKGKFLLQDSPTGRSRR----GQPRSPPTSQQ 301

  Fly   805 EAPSVQEDILSMNSDRELQEQKKAQKPKRKRYKKVQKEQENEKYLREQEIIISQSQ--------- 860
            |:|:::||                          :|...:...||...|:.:|..|         
Zfish   302 ESPALKED--------------------------MQCHSKEVPYLTTTEMYLSHWQTPPSPQRDP 340

  Fly   861 -MVEEDKVEEHHAHEA---PSEQQRELDLEHQQFLEEQLLQEEH-QLAMHEEEHHQMDDEQESHE 920
             .|.|:.||.....|:   |..|:...|:  .:.|::.:..:.| :|.:.|:...:.|.::    
Zfish   341 STVHENTVEVPSWRESILEPLGQKEASDI--LECLDDSVFLKRHSKLELDEKRRKRWDIQR---- 399

  Fly   921 VARLLEDQQPAEGTHLHVENEMLAEKEQPLIEDDDQEADDQNQNEHLSDDQQQEADQQLSIE--- 982
                :.:|:..:.....:....:.::.:|               |.||...:.|..:.:.:.   
Zfish   400 ----IREQRMFQRLQQRMNRRKVIQESEP---------------ELLSFHAEPEDVEYIMVTPFL 445

  Fly   983 ------QPQEHEENQSLSQDPLDE--QCTPTPNGKRRKRRR 1015
                  .|..:.:.|......|||  :|.|....||..|||
Zfish   446 PVVAFGSPLPNLKQQDFDLPWLDERSRCQPEVTKKRTPRRR 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12316NP_648752.1 PHA02666 504..>685 CDD:222914 18/110 (16%)
GBP_C <819..947 CDD:303769 20/142 (14%)
coiled coil 931..943 CDD:293879 0/12 (0%)
Trypan_PARP <1026..1130 CDD:114603
msl1aNP_001107940.1 MSL1_dimer 168..203 CDD:293406 9/35 (26%)
PEHE 349..466 CDD:291924 18/142 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C132165719
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.