DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep135 and Cep135

DIOPT Version :8

Sequence 1:NP_001189108.1 Gene:Cep135 / 39647 FlyBaseID:FBgn0036480 Length:1065 Species:Drosophila melanogaster
Sequence 2:XP_001076228.3 Gene:Cep135 / 305288 RGDID:1310726 Length:1140 Species:Rattus norvegicus

Alignment Length:1172 Identity:266/1173 (23%)
Similarity:507/1173 (43%) Gaps:202/1173 (17%)


  Fly    10 DLRCKLDIMGFTQTLPVLAIPLVQAVFGDLIKTTECLRDTKKKVAELLEEKTCWELGVEPYKCDN 74
            ::|.:||.:|:.|||.|.::|||:.:|.||:.|||.||..:....:..::...::..:||||.:|
  Rat    11 NIRKRLDQLGYRQTLSVDSLPLVEKLFSDLVHTTESLRQCRLSSVKAEKDSANFDFVLEPYKLEN 75

  Fly    75 SRLLAECNELHLQFLRDRE-------DYELRLCESERKIRNLE-LDKQH------LQSHNDGLQR 125
            :||..|.|||:|:.::.||       |.::.|.:|.|:..:|: |:.|:      |:..:.....
  Rat    76 TRLNKENNELYLELMKLREYSDKHIKDLKITLKKSSRETADLKFLNNQYVHKVRLLEKESKAKDE 140

  Fly   126 QLDALLTKQM---VSSVTNKKATAGIGRQTKKPFITTVRSGIAMPTTLGTSSSALKCTKCNAGVF 187
            ::..|..|.:   |.:...:|......||         |..|..|......||        ..|.
  Rat   141 KIQQLQEKNLRAVVQTPGGRKRNIAFRRQ---------RMQIDEPAPPSEVSS--------YPVP 188

  Fly   188 QKTTTTTKDGVTVTQT---SGQEELDKMQNDLTAAGEQLEFFKRKVEARNREIRRLNDMLAGGRP 249
            |.......|.:.|...   ..|||:.::|..|....:.::.:.|::|.|.|||.||:..:.|||.
  Rat   189 QPEDPYIADLLQVADNRIQELQEEVHQLQEKLAQMEKGVQDYSRQIELREREIERLSVAVDGGRS 253

  Fly   250 LAALAKDCCYKD----VGALSQDIDLLQREKSDLMMQVREFQDKMHDAMQRALSSEEDKIKLQTQ 310
            ...|:.:...|.    :..|:..:|.||:...:|..:::|..:.........::......||..:
  Rat   254 PDILSLETRNKTNEKLIAQLNIQVDFLQQANKELERRIQELMETKATVTTEVVNLSNRNEKLCQE 318

  Fly   311 LEELKEAALQVEQQANAEIDAKESELRQLQLELKKKGKDHRLTGGFASNQSDKHNLNERLNLLTR 375
            |.|:.:.|.|:|:.....::..:.||.:.:.|:|:             |.|:..||.|:::.|  
  Rat   319 LTEIDQMAQQLERHKEQVLETADRELGEAKKEIKR-------------NLSEMRNLEEKMSKL-- 368

  Fly   376 REEELQATNEKHKKKI-------QKMQAKILELQKELKDQNK--------HSNVTLDEEKIRL-- 423
             :.||..:| |.|:::       ..::..:.:|::|.:..||        ...:||:.|::||  
  Rat   369 -QWELDVSN-KEKERLNGELLLKSDLETVVHQLEQEKQRLNKKLQSFAVTERELTLEVERMRLEH 431

  Fly   424 -------------------SSERDFFQKEYLRLM------------------------SKTGSES 445
                               ..|||:::||..:|.                        .|....|
  Rat   432 GIKRRDKSPSRLDTFLKGIEDERDYYKKELEKLQHLIQRRSCSVIYCAREKPPIIKCSEKGDCNS 496

  Fly   446 EIAFLHAQIKSKDE-----------------ELKALRSE------LFHGGKQQFSPQKSVQYETL 487
            :|   |...:.:||                 .:|.|.:|      |:...|::.|..:.....:|
  Rat   497 DI---HLITRERDELQRMLERFEKYMEDIQSNVKLLTAERDRLSVLYKEAKEELSALRQESTGSL 558

  Fly   488 PPPTASSITSTVTSNTSDCVQAAIARVERERDCARTELERVRCERDTLREKQLSTVQLHADELQA 552
            .|           :|...|       :|:|::.|.::|.|:..|::.|||| |..:|    ||..
  Rat   559 AP-----------NNLVSC-------IEKEKERALSDLRRITAEKEALREK-LKNIQ----ELNV 600

  Fly   553 LRLRNEELNDRLRQMERDNRELNSARLPTETNLVLLKEDLLQMR-------QRVASMQTEIDQLK 610
              :...||...:..:...|.:|.:.:...::.::::||.:..:.       |:::.:..:....|
  Rat   601 --VGKSELEKTIEHLTYINHQLENEKYELQSKILIMKETIESLESKSKLQAQKLSHVTGDSSHQK 663

  Fly   611 TENDQITMLNDQNERIIADYQSKLLVAERQRQSADVRASTLDSSRESNRSEVTQLRMDLGALRQT 675
            ||.:.:.::::|.:|.:.|.|.:|.:...:.:||..:...|:...||....:|....:..|:::|
  Rat   664 TEMNSLRIVSEQLQRSLDDCQHRLSIKRGELESAQEQIKALEQKLESLSHRMTMQSEETHAMKKT 728

  Fly   676 YISLEHEKDTLLHQLDTKTERVYKLEYELKDCKEKRNALEQNVKDLEDQLRKLANRNRQRDSELT 740
            ...::.|||.|...:|.|||::..|:..|...::....|:..|.:.|..|.:|......||.|:.
  Rat   729 IGVMDKEKDFLQETVDEKTEKIASLQDSLISKEKAITQLKVTVSECESSLNQLQETLTNRDREIN 793

  Fly   741 ETSTESKTLRQQIVALKASRDEAIAENRRLMDKLSDAQVEARTLQKKLTDSELQVANMKQQLHKY 805
            ....:.....:::..:..||:.:..|||||.|.|:....|.:.:..:|..:..:...||.::|||
  Rat   794 SLRRQLDATHKELDDVGKSREISYKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKY 858

  Fly   806 VQEVKKAEDLLIQKVSSKFKEKERDDMLDQYHCLTQGQATLEGNNQSLECEAVEFRRQICELECE 870
            :.||.:.|.|:..      ||||..|:||::..|.......|...|..|.|....|.::..::.|
  Rat   859 ITEVSRWESLMAA------KEKENKDLLDRFQMLHNRAEDWEIKAQQAEGENSSVRLELLSIDTE 917

  Fly   871 VHSLKEQLQLRQ-------CALHDMEVQLTAARASVRCLERELENARDDIRVQKVDLEARKELCD 928
            ...|:|:::|.:       .|.|..|.|:::...::..||.||.....:......|:.:.:|||.
  Rat   918 RRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSQLEEELRRHESEKATVLGDVSSLRELCI 982

  Fly   929 KLDVERSKLNAELNDVNEIRKKLEKQCEKLRDE---LQQSLAINQVTNETTDLMLGRLHNDQQHQ 990
            |||..:..:..:||......::...:.|.::.|   |::.|...:.|..:.:.:|. .:.|::.|
  Rat   983 KLDSGKDIMTHQLNSKGLELERAVAELENVKSESELLKKQLMTERQTINSLESLLA-TNRDKEFQ 1046

  Fly   991 EDDDIRSKHEMDRLQRQLQQTLDQLQEERVRCRHHEE--LAEKWEQQVRD---LRRNLADDRYNQ 1050
            ..   .:.||.|...:.|::.|: |.|.::..:..|.  |..|..|...|   |:|.:::::|.:
  Rat  1047 SH---LTSHEKDTEIQLLKEKLN-LSESKLTTQSRETSMLRTKVTQLQTDYDNLKRLMSNEKYER 1107

  Fly  1051 AR 1052
            .|
  Rat  1108 ER 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cep135NP_001189108.1 Smc <203..963 CDD:224117 189/867 (22%)
DUF342 <302..421 CDD:302792 29/134 (22%)
Cep135XP_001076228.3 Smc 202..994 CDD:224117 194/899 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KKT
Hieranoid 1 1.000
Homologene 1 1.000 H45709
Inparanoid 1 1.050 259 1.000 Inparanoid score I2992
OMA 1 1.010
OrthoDB 1 1.010 D139407at2759
OrthoFinder 1 1.000 FOG0002578
OrthoInspector 1 1.000 T617522
orthoMCL 1 0.900 OOG5_132847
Panther 1 1.100 LDO PTHR23159
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.930

Return to query results.
Submit another query.