DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: shd and Cyp12b2

Sequence 1:NP_001261843.1 Gene:shd FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:509 Identity:135/510 (26%)
Similarity:232/510 (45%) Gaps:55/510 (11%)


  Fly    54 RRRRGIWDIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDI-VLEVMPSNVPIVHL 117
            ::.|...:||||..:..|.    |.:.....:.|.|.::...:...|||| .:..|......|..
  Fly    48 QQARSFGEIPGPSLLRMLS----FFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFT 108

  Fly   118 YNRDDLEKVLKYPSKYPFRPPTEIIVMYRQ-SRPDRYASV-GIVNEQGPMWQRLRSSLTSSITSP 180
            ||.||.|...:....:|.|...|.:..||: .|||.:..| |:.::||..|..:|:.:...:...
  Fly   109 YNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKV 173

  Fly   181 RVLQNFLPALNAVCDDFIELLRARRDPDT-LVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTK 244
            :.::..||.|:.:..:||:.|..:|:|:| .:..:|.....:...|::..:.|..|||.|: |..
  Fly   174 QNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLS-DNP 237

  Fly   245 QPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDHELEELKKS 309
            .| ...:||..::..|...........:|.::.|..::.|.:..|.|.|:.|..|:..:....|:
  Fly   238 DP-NADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKN 301

  Fly   310 AACEDDEAAGLRSIFLNILELKDLDIRDKKSA---IIDFIAAGIETLANTLLFVLSSVTGDPGAM 371
                ||  ...:.:...:||      .:||.|   ::|.:.|||:|.::..|.:|..:..:|...
  Fly   302 ----DD--GKTKCVLEQLLE------HNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQ 354

  Fly   372 PRILSEFCEYRDTNILQDALT-----NATYTKACIQESYR---LRPTAFCLARILEEDMELSGYS 428
            .::..|......|.  :|:||     |..|.:|||:|..|   :.|..|   ||..:|:.||||.
  Fly   355 EKLRRELLRILPTT--KDSLTDQNTKNMPYLRACIKEGLRITSITPGNF---RITPKDLVLSGYQ 414

  Fly   429 LNAGTVVLCQNMIACHKDSNFQGAKQFTPERWID----------PATENFTVNVDNASIVVPFGV 483
            :..||.||...:...:.|..|..:.:|.||||:.          ||     ....|..:.:|||.
  Fly   415 VPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPA-----ARTRNPFVYLPFGF 474

  Fly   484 GRRSCPGKRFVEMEVVLLLAKMVLAFDVSFV--KPLETEFEFLLAPKTPLSLRL 535
            |.|:|.|||..|:|:..||.:::.::.||::  .|:|.|...:|:|...:..:|
  Fly   475 GPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKL 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 132/492 (27%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 126/480 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24305
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.