DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG42526

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster

Alignment Length:201 Identity:44/202 (22%)
Similarity:74/202 (37%) Gaps:55/202 (27%)


  Fly    25 VKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGANTYYL 89
            ||.:..:::::...|.|    |.||..::...:.||:.|:.||:::|..|.|..:......:...
  Fly    12 VKRNVSIFEKYHTRYDR----KQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAATRSNIR 72

  Fly    90 N-SELKFLQKHI-------------------TPGVPVPLRG-----------RRSRP-------K 116
            . .||.||::||                   .|||.|..:.           ...:|       |
  Fly    73 KFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGITEFQPDEFIIEYK 137

  Fly   117 GQEEHDEGDPETPVEAI-----------LEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNE 170
            |:||:......:..|.|           |..|..||| |.| .||:......|..::..:...::
  Fly   138 GEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSF-NGE-GQSQTQAKFMSVMNLIESALKDK 200

  Fly   171 PSSIMD 176
            |:...|
  Fly   201 PAEPQD 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 20/76 (26%)
BESS 226..260 CDD:281011
CG42526NP_001163401.1 MADF 8..85 CDD:214738 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.