DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG11504

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster

Alignment Length:353 Identity:71/354 (20%)
Similarity:119/354 (34%) Gaps:108/354 (31%)


  Fly    31 LYDRHDDNYLRKSTVKNAWKEISNEMRNS--VKSCKERWRNIRSSYARSIKLHHGANTYYLNSE- 92
            |:|...|.|.:|...:....|:|..:..:  :...::::..:|:.|.|.|........|  ||: 
  Fly    21 LWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISRMKRKEPY--NSKW 83

  Fly    93 -----LKFLQKHITPGVPVPLRGRRSRPKGQEEHDE-------------GDPETPVEAILEMVHS 139
                 |.||..      |...|..:.|.|...:.||             .|..||..      |:
  Fly    84 FGFKNLVFLSS------PYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTPAN------HN 136

  Fly   140 PS--------FLNSEHAQSR------------HSTDPASATDVE--------ATQFNNEPSSIMD 176
            .:        :|...||.||            ...|....:::|        |.:.:....|:.:
  Fly   137 SNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSLNE 201

  Fly   177 FEDTVPAE------MRTESDSSEKEA------KVGEITLYRVPLLEFPKTSTRCIEALP-----I 224
            .|:|.|.|      |......:..||      :.||:.....|.   ..|.:..:..:|     |
  Fly   202 QEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPT---QSTGSSSVHVMPTRIIKI 263

  Fly   225 MDFDDAFLQGLRPEIKHMNFHQKLY---FKRRVYDLLGEIFHSEQSASSTHPAQPHPRENVNGT- 285
            ...|.:..|    |..:...|.:|:   .||..|:.      |..|.::|....|....:.||| 
  Fly   264 QRRDTSSGQ----EDSYFEEHTQLHPPPVKRMYYEA------SPASHNTTSILSPALESSANGTA 318

  Fly   286 ---LSTTSSLSSANPLQHMGLMLQLPKL 310
               |:|:..::.:|        |:|||:
  Fly   319 SSVLTTSPGITMSN--------LRLPKV 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 17/77 (22%)
BESS 226..260 CDD:281011 8/37 (22%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 16/73 (22%)
CytochromB561_N 238..>409 CDD:286826 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.