DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and jigr1

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster

Alignment Length:267 Identity:59/268 (22%)
Similarity:100/268 (37%) Gaps:62/268 (23%)


  Fly    28 HPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSY-ARSIKLHHGANT----Y 87
            ||.||||.:..:..|..|.:.|::|::::.....|.:||...:|:.| ....::.:|.:|    :
  Fly    40 HPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQW 104

  Fly    88 YLNSELKFLQKHITPGVPVPLRGRRS-RPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSR 151
            .|...|:||..||.|        ||| :....:|.||                         ::.
  Fly   105 PLFESLQFLGDHIRP--------RRSFKNMSVKEEDE-------------------------ETY 136

  Fly   152 HSTDPASATDVEATQFNNE---PSSIMDFEDTVPAE--MRTESDSSEKEAKVGEITLYRVP---- 207
            ...|..|.::.......:|   .|.|.|.|..:|..  :....::|::..|....|...:|    
  Fly   137 EVDDCRSDSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKG 201

  Fly   208 LLEFPKTSTRCIEALPIMDFDDAFLQGLRPE---IKHMNFHQKLYFKRRVYDLLGEIFHSEQSAS 269
            ...|.::..|..:..|........:..:|..   .:|::.|..   ||||.|.|        |.|
  Fly   202 YNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPS---KRRVDDSL--------SIS 255

  Fly   270 STHPAQP 276
            ..:|.||
  Fly   256 GYYPTQP 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 22/77 (29%)
BESS 226..260 CDD:281011 9/37 (24%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.