DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG6276

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:367 Identity:66/368 (18%)
Similarity:119/368 (32%) Gaps:118/368 (32%)


  Fly    20 KICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGA 84
            |:..:|:....:|:.....|..:..|:|.|:|:..::..:..:...:|.|:|.|:.|..      
  Fly    32 KLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISFRREY------ 90

  Fly    85 NTYYLNSELK----------FLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILE---- 135
             |.||..::.          ||..:        ||.:..:||..        :|.|:..|.    
  Fly    91 -TNYLEEKVPPCWSYFDRMFFLHPY--------LRKKHQQPKSL--------DTQVQDALAHLSN 138

  Fly   136 -----------MVHSPSFLNSEHAQSRHSTDPASATD------VEATQFNNEPSSIMDFE----- 178
                       .:...|.:..:...|.|.:.||...|      .||...|:|...||:.|     
  Fly   139 LSSRMQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNS 203

  Fly   179 --------DTVPAEMRTESDSSEKEA------KVGEITLYRVPLLEFPKTSTRCIEA-------- 221
                    :.:.:|.....|..|:||      :..:..|:::.    |.:|:...||        
  Fly   204 RYHGQLDGNDIKSECEEPVDDYEQEAHEPEEDEQDDQDLHKMA----PTSSSSSAEAQRRYANQH 264

  Fly   222 ----------LPIMDFDDAFLQGLRPE----------IKHMNF------HQKLYFKRRVY----D 256
                      |.:..:.|.....:||.          :..:|:      |..:.|.|..:    |
  Fly   265 SHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAVAGVNYSAQPTAHPNISFVRPTFSKPVD 329

  Fly   257 LLGEIFHSEQSASSTHPAQPHPRENVNGTLSTTSSLSSANPL 298
            |:....|:........|......|   ..|.|.|:.:.|.|:
  Fly   330 LVSTTTHAGGGGGGGVPGTAGLSE---AELPTPSTAAVATPM 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/90 (20%)
BESS 226..260 CDD:281011 9/54 (17%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/99 (19%)
BESS 431..465 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48655
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.