DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and Mes2

DIOPT Version :10

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:154 Identity:32/154 - (20%)
Similarity:50/154 - (32%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KICHLVKLHPCLYDRHDDNYLRKSTVKN-AWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHG 83
            |:..:|..:|.|:|....|:......|| ||:.|..|.....:.....::::|.||.|  :|.| 
  Fly    62 KLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRR--ELAH- 123

  Fly    84 ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNS--- 145
                                  |.|.|...:||                 ..:..:..||..   
  Fly   124 ----------------------VKLMGNGFKPK-----------------WSLYEAMDFLRDVIR 149

  Fly   146 EHAQSRHSTDPASATDVEATQFNN 169
            |...:.|:||.:..|.......||
  Fly   150 ERKGASHATDLSLTTYGHINNNNN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/80 (23%)
BESS 226..260 CDD:460758
Mes2NP_730768.1 MADF 62..149 CDD:214738 25/128 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.