DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and Mes2

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:154 Identity:32/154 - (20%)
Similarity:50/154 - (32%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KICHLVKLHPCLYDRHDDNYLRKSTVKN-AWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHG 83
            |:..:|..:|.|:|....|:......|| ||:.|..|.....:.....::::|.||.|  :|.| 
  Fly    62 KLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRR--ELAH- 123

  Fly    84 ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNS--- 145
                                  |.|.|...:||                 ..:..:..||..   
  Fly   124 ----------------------VKLMGNGFKPK-----------------WSLYEAMDFLRDVIR 149

  Fly   146 EHAQSRHSTDPASATDVEATQFNN 169
            |...:.|:||.:..|.......||
  Fly   150 ERKGASHATDLSLTTYGHINNNNN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/80 (23%)
BESS 226..260 CDD:281011
Mes2NP_730768.1 MADF 62..149 CDD:214738 25/128 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.