DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG8765

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster

Alignment Length:337 Identity:61/338 (18%)
Similarity:116/338 (34%) Gaps:112/338 (33%)


  Fly    24 LVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK-----LHHG 83
            |::....:|:..::||.........|:||:.:::.|||.|:.:|:.:|..|||..|     :|..
  Fly   322 LIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKRLRTLMHID 386

  Fly    84 ANTYYLN-SELKFLQKHITPGVPVPLRGRRSRPKGQEEHDE-------GDPETPVEAILEMVHSP 140
            |.:.:.: :.|.||||:|             :.|..|...:       .||...:|..:...|||
  Fly   387 ATSRWKHYNSLSFLQKYI-------------QQKTLESDSQLSMLLPKNDPVRELEDHMTQSHSP 438

  Fly   141 S----FLNSEHAQSR-------HSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEK 194
            .    .|.|..:.|:       |.|.|..|...:..|...|..           :.:.:....::
  Fly   439 PTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQQQQEEQH-----------QQQQQHQQQQQ 492

  Fly   195 EAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLG 259
            :.:..|:                |:.....||.::           ::|               |
  Fly   493 QQQASEL----------------CVATYDDMDIEN-----------YIN---------------G 515

  Fly   260 EIFHS---------EQSASSTHPAQPHPRENVN-------------GTLSTTSSLSSANPLQHMG 302
            ::.|:         |:..::|...||..:::.:             ...|..|::|....|....
  Fly   516 DVHHNDDDVEDDEDEEMETTTAAEQPPQQQDQHVMTYDHEDGPVYMAVPSVGSAMSKQEQLSDGA 580

  Fly   303 LMLQLPKLVSKA 314
            ..|:..:|.|.|
  Fly   581 TSLENQQLQSTA 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 24/82 (29%)
BESS 226..260 CDD:281011 3/34 (9%)
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 25/96 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.