DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG6163

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster

Alignment Length:369 Identity:63/370 (17%)
Similarity:122/370 (33%) Gaps:111/370 (30%)


  Fly    10 PPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKER--WRNIRS 72
            |..:.:...|::...:|.:|.::|.::..::.:|.....|.||:.:....|.:.|.:  |..::.
  Fly     2 PKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKY 66

  Fly    73 SYARSIK---LHHGA-NTYYLNSELKFLQKHIT-------------------------------- 101
            .|...:.   ||... ||.:.:.|......:||                                
  Fly    67 HYHNLVHRQILHKDRFNTKWEHFEPMSFMYNITVAKIVGAQSSGGSGGGTSSDAPSTATEAATVG 131

  Fly   102 ---------PGVPVPLRGRRSRPKG---------------------QEEHDEGDPETPVEAILEM 136
                     |.:|....| |.||.|                     |..|.:|...| ..|...:
  Fly   132 EEPAAPVAPPPLPTATHG-RGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMT-YTAFTGL 194

  Fly   137 VHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPA--EMRTESDSSEKEAKVG 199
            |..|:.:.||...:     |.......::..|:....|:|...|.|:  ..|..|:..:.:::..
  Fly   195 VPPPATVASETVAT-----PPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTS 254

  Fly   200 EITLYRVPLLEFPKTST-----------RCIEALPIMDFDDAFLQGLRPEIKH---MNFHQKLYF 250
            .:  ::...:|...|.|           |.::.|..........|..|...:|   |:|.:::..
  Fly   255 AV--WKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILL 317

  Fly   251 KR---------RVYDLLGEIFHSEQSASSTHPAQ-------PHP 278
            |:         ::.:::.|..|.:|  :..||:|       |.|
  Fly   318 KKVDEREQTREQIQEIVSEQQHHQQ--TQHHPSQHLHHYRPPQP 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 16/86 (19%)
BESS 226..260 CDD:281011 6/46 (13%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738 16/86 (19%)
MADF 226..316 CDD:214738 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48630
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.