DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG6683

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster

Alignment Length:151 Identity:37/152 (24%)
Similarity:60/152 (39%) Gaps:12/152 (8%)


  Fly    18 NAKICHLVKLHPCLYDRHDDN---YLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK 79
            :.::..||:.:|.||:|...|   ...|......|..|:..:.:...:|..||.::.:...|.:.
  Fly     5 DTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELA 69

  Fly    80 LHHGANT---YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPS 141
            ......|   :.|...|||||.|..| :.....|..||...:...:..|.|.|::..::     .
  Fly    70 KEKAGGTGSDWSLLPHLKFLQHHHHP-INHRNSGDLSRSTLKSSDEVNDDEDPLQEAMD-----E 128

  Fly   142 FLNSEHAQSRHSTDPASATDV 162
            .|....|.....|:||.||.|
  Fly   129 QLAVAGAAPAPPTNPAHATPV 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 22/86 (26%)
BESS 226..260 CDD:281011
CG6683NP_648232.1 MADF 7..94 CDD:214738 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.