DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and hng1

DIOPT Version :10

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:214 Identity:44/214 - (20%)
Similarity:89/214 - (41%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK---LH----HGANT 86
            |.|||....::......:..|.::::.:..|:...:.||..:|..|:|.:|   ||    .|.|.
  Fly    23 PSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLHPSGEFGHND 87

  Fly    87 YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDP--------------ETPV--EAILE 135
            ::  .::.||:..:        |.||.| :|:|...|..|              ..|:  |.::|
  Fly    88 FF--RKMDFLRDFV--------RKRRER-RGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIE 141

  Fly   136 MVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESD---SSEKEAK 197
            ...|.::   :..:.:|..|  :..:...|| :...|.:::.:|....|..:..:   .:|.|.|
  Fly   142 EQGSHAY---DEGEEQHDYD--AKLESHTTQ-SETYSVVVEADDGQEPEQESFDEFLGDAECEQK 200

  Fly   198 VGEITLYRVPLLEFPKTST 216
            |..:|::  |.:..|..::
  Fly   201 VKVVTIH--PEIAAPNATS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/77 (23%)
BESS 226..260 CDD:460758
hng1NP_611558.2 MADF 15..98 CDD:214738 18/76 (24%)
BESS 264..298 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.