| Sequence 1: | NP_001261840.1 | Gene: | CG3919 / 39582 | FlyBaseID: | FBgn0036423 | Length: | 318 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611558.2 | Gene: | hng1 / 37412 | FlyBaseID: | FBgn0034599 | Length: | 315 | Species: | Drosophila melanogaster |
| Alignment Length: | 214 | Identity: | 44/214 - (20%) |
|---|---|---|---|
| Similarity: | 89/214 - (41%) | Gaps: | 45/214 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 PCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK---LH----HGANT 86
Fly 87 YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDP--------------ETPV--EAILE 135
Fly 136 MVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESD---SSEKEAK 197
Fly 198 VGEITLYRVPLLEFPKTST 216 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3919 | NP_001261840.1 | MADF | 20..100 | CDD:214738 | 18/77 (23%) |
| BESS | 226..260 | CDD:281011 | |||
| hng1 | NP_611558.2 | MADF | 15..98 | CDD:214738 | 18/76 (24%) |
| BESS | 264..298 | CDD:281011 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45438511 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||