DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG7745

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster

Alignment Length:338 Identity:73/339 (22%)
Similarity:122/339 (36%) Gaps:78/339 (23%)


  Fly    25 VKLHPCLYDRHDDNYL-------RKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK--- 79
            |..|..:|:| ...||       :..|...||:.|:.::|..|.:||:||:.:|..|....|   
  Fly    10 VAQHGVIYNR-QKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGD 73

  Fly    80 --LHHGANTYYLNSELKFLQKHITP-----GVPVPLRGRRS-RPKGQEEHDEGDPETPVEAILE- 135
              ::...:..|| .::|||.:||.|     .||..|...:| ...|..|:........::.:.: 
  Fly    74 PPVYEHLSRPYL-EKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMKNVSQF 137

  Fly   136 -------MVHSPSFLNSEHAQSRHSTDPASATD-------VEATQFNNE--------------PS 172
                   :.|.|   :.:||.|..|...|||.:       :||.|...:              .|
  Fly   138 GSSGQSHLYHQP---DQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQS 199

  Fly   173 SIMDFEDTVPAEMRTESDSSEKEAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGL-- 235
            .:......|.|.|...|...:.:.|.|.:.:..........|||......|:    .:.|||:  
  Fly   200 QMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNGAQNSAGSLTSTSSSMKSPL----SSPLQGIGA 260

  Fly   236 ---RPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQPHPRENVNGTLSTT-SSLSSAN 296
               .|:.:.....|:                .:|.|....||.......|:.:.|.| :|:.:::
  Fly   261 GSHHPQQQTQQQQQQ----------------QQQQAQQQSPASEQQLPVVHSSSSATGASIGNSS 309

  Fly   297 PLQHMGLMLQLPK 309
            .||.....:..||
  Fly   310 TLQMQQSHVYNPK 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 25/87 (29%)
BESS 226..260 CDD:281011 5/39 (13%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.