DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and Coop

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:333 Identity:67/333 - (20%)
Similarity:119/333 - (35%) Gaps:85/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERW----RNIRSSYARSIKLHHGAN 85
            |...|.|:.|::.|..::|.:...|.|:..::......|:.:|    .|.|..|.|:...:...:
  Fly    47 VSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLSNETPS 111

  Fly    86 TYYLNSELKFLQKHITPGVPVPLRGRRSRPK--------------GQEEHDEGDPETPVEAILEM 136
            ::...::::|::..:...:   :|..||..|              |.:::| ..|....|.|.|:
  Fly   112 SWRFYNDMRFMEPAVHENI---MRQTRSSSKKHPPGHWTENNNVLGPDKYD-SMPIVATEPICEL 172

  Fly   137 VHS-------PSFLN-SEHAQSRHSTDPASATDVEATQFNNEPSSIM-------DF-EDTVPAEM 185
            .||       |||.: |...:.|....|      |..:|.:|||...       || ||.....:
  Fly   173 SHSYDSELHQPSFSDISSFFEDRDCQPP------ENKRFKSEPSQREEDEEDDDDFDEDAASENL 231

  Fly   186 RTESDSSEKEAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYF 250
            ..|..:....|..|..|                   :.::|.||...|.:.....:...|.    
  Fly   232 EEERGNRADAASSGVFT-------------------IEVLDDDDEMEQAVTKTKANNTSHG---- 273

  Fly   251 KRRVYDLLGEIFHSEQSA----SSTHPAQPHPRENVNGTLSTTSSLS------SANPLQHMGLML 305
                    |....|||.|    :|..|....|.:.::..::|.:..|      .|:.:..:.||.
  Fly   274 --------GSSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMP 330

  Fly   306 QLPKLVSK 313
            .|.:|.|:
  Fly   331 FLQRLDSR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 15/78 (19%)
BESS 226..260 CDD:281011 5/33 (15%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 15/76 (20%)
BESS 320..353 CDD:281011 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.