DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG10949

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:119/292 - (40%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INAKICHLVKLHPCLYDRHDDNYLRKSTVKN-AWKEISNEMRNSVKSCKERWRNIRSSYARSIKL 80
            :|.::..|||.||.|||||.....:....|| ||:|||..:..|.:.|..||:.:|..:.|..:.
  Fly   137 LNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRS 201

  Fly    81 HHGAN-----TYYLNSELKFLQKHITPGVPVPL-----RGRRSRPKGQEEHDEGDPETPVEAILE 135
            |. .|     |:...::|.||.:|...|||:.|     |||..:...........||..|.:..|
  Fly   202 HQ-INQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGE 265

  Fly   136 MVHSPSFLNSEHAQSRHSTDPASATD----------------VEATQFN---NEPSSIMDFEDTV 181
            .:..        |...:|||.....|                .:||.::   :|.::..|.|...
  Fly   266 QIWG--------ADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQ 322

  Fly   182 PAEMRTESDSSEKEAKVGEITLYRV-PLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFH 245
            ..::.|.:.::.:|.   ..|:.|| |::|  ::|:...:::|.....|..|..:     ..|..
  Fly   323 QLQVTTTTPATSEEI---IHTIARVNPVVE--ESSSLPGDSVPSAAISDKLLTTV-----IANME 377

  Fly   246 QKLYFKRRVYDLLGEIFH---SEQSASSTHPA 274
            ..|...|   :|..:|.|   .|:...||.||
  Fly   378 TVLQQSR---ELQAQIHHEQEQEREQRSTQPA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 29/85 (34%)
BESS 226..260 CDD:281011 6/33 (18%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 30/86 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.