DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and brwl

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster

Alignment Length:385 Identity:84/386 (22%)
Similarity:138/386 (36%) Gaps:121/386 (31%)


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHH 82
            |.:..:||:.|.||||:....|..:...:.||..||.|.|.||..|||||||:|:..:|.||...
  Fly    58 NIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYIKQQS 122

  Fly    83 GA----NTYYLNSELKFLQKHITPGVPVP-LRGRRSRPKG----------QEEHDEGDP------ 126
            |:    ..|||...:.||         :| |:..|:..:|          .::|.:..|      
  Fly   123 GSEPQHKPYYLTEHMAFL---------LPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPFLLHPA 178

  Fly   127 -----------ETPVE--------------AILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQ 166
                       .|.:.              .:|||.:|.|..:.|  ::..:.|||....:...:
  Fly   179 LHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDE--ETIDAFDPAVTNTLGMNR 241

  Fly   167 FNNEP---SSIMDFEDTVPAEMRTESDSSEKE-------AKVGEITLYR-------VPLLEFP-- 212
            .::.|   |::.......||...|.|..|.|.       |:.|...:|.       .||...|  
  Fly   242 TSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPPLHYHPHS 306

  Fly   213 ----------------------KTSTRCIEALPIMD--------------FDDAFLQGLRPEIKH 241
                                  :..|.| ||...|.              .|..|.:.:.|::..
  Fly   307 HPHPLTLSMDHHPASYEPGSTKRIKTEC-EATSTMTNAGSIYGGLSSSEVADMEFFRSILPDLAT 370

  Fly   242 MNFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQPHPR-ENVNGTLSTTSSLSSANPLQH 300
            :...|:..||..:.:|:.::.       :.:|||.|.. ..|:|.::.:...|:...::|
  Fly   371 LTPQQRRKFKIGILELIDDVV-------TRYPAQDHSNGGGVSGVVNGSGGSSNGGSVKH 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 33/84 (39%)
BESS 226..260 CDD:281011 7/48 (15%)
brwlNP_609298.1 MADF 60..145 CDD:214738 35/94 (37%)
BESS 356..389 CDD:281011 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131196485
eggNOG 1 0.900 E1_2DZH1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4064
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.