DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG11723

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster

Alignment Length:323 Identity:63/324 (19%)
Similarity:104/324 (32%) Gaps:125/324 (39%)


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSY-------- 74
            |.::...|....||:|.:.....|.......|..::..|:..|..||:|::.:|.||        
  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQ 69

  Fly    75 ARSIKLHHGANTYYLNSELKFLQKHITPG--VPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMV 137
            .:.|::.|..   |..| |:|:::...|.  ||.|                  ||          
  Fly    70 QKRIEMSHWP---YFRS-LEFMRQIFDPEGLVPFP------------------PE---------- 102

  Fly   138 HSPSFLNSEHAQSRHST-----------DPASATDVEATQ--FNNEPS----------------- 172
              |..:|:|..:....|           |...:.|.|..:  |..|||                 
  Fly   103 --PFVMNTEQPEVFEPTRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLD 165

  Fly   173 --------SIMDFEDTVPAEM-------------------RTESDSSEKEAKVGEITLYRVPLL- 209
                    |..|...|:|..:                   |..|.|::            |||| 
  Fly   166 SSSSGAHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSPSND------------VPLLN 218

  Fly   210 ----EFPKTSTRCIEALPIM--DFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQ 266
                :..|::|.     |.:  |.|.:||..:.|.:|.::....|.|:..:..:|.|:...:|
  Fly   219 GYASQASKSTTE-----PDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVELREEDQ 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 20/88 (23%)
BESS 226..260 CDD:281011 9/34 (26%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/88 (23%)
BESS 236..270 CDD:281011 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48564
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.