DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG8119

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster

Alignment Length:271 Identity:54/272 (20%)
Similarity:111/272 (41%) Gaps:54/272 (20%)


  Fly    11 PPNVYAINAKICHLVK---LHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRS 72
            |.|    |.:..||::   |.|.::|......||:..:...|.::||.:...|..||.||:::|:
  Fly     9 PTN----NLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRN 69

  Fly    73 SYARSIKLHHG-ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEM 136
            :|  ..|:|.| |.::..:.:::|::....|                  |   .|:||....:::
  Fly    70 NY--RTKIHQGNAWSWPHSKQMEFVRDVFPP------------------H---KPKTPARCRVQV 111

  Fly   137 VHSPSFLN-SEHAQS--RHSTDPASATDVEATQ----FNNEPSSIMDFEDTVPAEMRTESDSSEK 194
            ..|...|: .::.||  .:|.......:.||.:    ..:||:..:|.::.|...:.|:....:.
  Fly   112 KKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQT 176

  Fly   195 EAKVGEITLYRVP----LLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVY 255
            ......:.::|.|    :.:....|.|            .||..:.|.::.::...|..|:....
  Fly   177 NLDFILLPIFRAPPPSAMAKISNESNR------------HFLLSMVPMLRSLSDRSKERFRSWTR 229

  Fly   256 DLLGEIFHSEQ 266
            .:|.|:..:|:
  Fly   230 RVLREMLIAEK 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 22/84 (26%)
BESS 226..260 CDD:281011 6/34 (18%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 22/82 (27%)
BESS 201..234 CDD:281011 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.