DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG4404

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster

Alignment Length:325 Identity:73/326 (22%)
Similarity:126/326 (39%) Gaps:110/326 (34%)


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKL-- 80
            |.:....|:..|||::.....|.:|..|:.||::::|:::::|::|:||||.||||:.||:||  
  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLAR 79

  Fly    81 ---HHGANTYYLNSELKFLQKHITPGVPVPLRGRRS----------RPKGQ----EEHDE----- 123
               ..|...|||:..|:||         ||....||          |..||    ::.||     
  Fly    80 TQTGRGKRKYYLSKYLQFL---------VPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAE 135

  Fly   124 -----GDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFE-DTVP 182
                 .|.|.|::..:.        ..||.:::.             |...:|::.:... .::.
  Fly   136 EEAKVSDGEMPLDVQVS--------EEEHRRNQE-------------QDREQPTACLPLRLHSIK 179

  Fly   183 AEMRTESDSSEKEAKVGEITLYRVPLLEF------------------------------------ 211
            .|..:.:.:.:.|..|.:.:|..||....                                    
  Fly   180 VEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPP 244

  Fly   212 PKTSTRCIEALPIM-----------DFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSE 265
            |:.:|   .||.:.           |.|.:||..|.|.||.||..|...|:::|..|:.:|..::
  Fly   245 PQPAT---SALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDILDNK 306

  Fly   266  265
              Fly   307  306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 31/85 (36%)
BESS 226..260 CDD:281011 14/34 (41%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 33/95 (35%)
BESS 267..301 CDD:281011 14/34 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131196404
eggNOG 1 0.900 E1_2DZH1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4064
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0012211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.