DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and CG45071

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster

Alignment Length:254 Identity:48/255 (19%)
Similarity:89/255 (35%) Gaps:83/255 (33%)


  Fly     8 IAPPPNVYAINA-KICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIR 71
            :||..:...:|. :..|.::..|.:::|  :.:..|:.::..|.|:|...:......|.:|:.:|
  Fly     1 MAPKKSTIVLNVEQFIHDIEERPAIWNR--NFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLR 63

  Fly    72 SSYARSIK---------------------LHHGANTYYLNSELKFLQKHITPGVPVPLRGRRSRP 115
            .::....|                     ||     ||   .|.||..|:          |...|
  Fly    64 DNFRVEYKRIPRADNGDFMVDPATFESKWLH-----YY---ALLFLTDHM----------RHRLP 110

  Fly   116 KGQE-------EHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSS 173
            |.::       :..|...:|.||        |...|....:.:.|.:.....::||    :..:|
  Fly   111 KNEQDQSFYFSQQSEDCEKTVVE--------PDLTNGLIRRLQDSDEDYDEEEMEA----DGEAS 163

  Fly   174 IMDFEDTVP-------------AEMRTESDSSEKEA------KVGEITLYRVPLLEFPK 213
            ....|:|:|             ..:.|.:..:::||      |.|   |.|..|:|..|
  Fly   164 EATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAG---LLRAQLMELEK 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 19/101 (19%)
BESS 226..260 CDD:281011
CG45071NP_730024.1 MADF 14..106 CDD:214738 19/112 (17%)
BESS 384..418 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.