DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and madf-10

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans

Alignment Length:267 Identity:36/268 (13%)
Similarity:85/268 (32%) Gaps:92/268 (34%)


  Fly    16 AINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRN--------SVKSCKERWRNIRS 72
            ::...:|..:...|.|:|...:. :..:..||.:.|:...:..        :::..::.|:|::.
 Worm    48 SVRFAMCEAIAHRPGLWDSTREK-VSSAARKNLFAEVVEVINQQFVLSPPLTIEEIEKHWKNLKD 111

  Fly    73 SYARSIKLHHGANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMV 137
            :|.                                    ::|.|...:||    ..|:....:..
 Worm   112 TYV------------------------------------KTRRKLTFDHD----GCPIRPKWKFF 136

  Fly   138 HSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKVGEIT 202
            .|..||:|.:...       ........||..:|..:.            :..||:||.      
 Worm   137 DSLMFLDSVNQND-------FVMKKRPMQFQGQPYDLY------------QGPSSKKEK------ 176

  Fly   203 LYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQS 267
                            :|.:|..::.: |.:.|...:|.:.:..:::: .::...:.:|.:..|.
 Worm   177 ----------------LEEMPSDEYME-FCRSLYLPLKEIGYKDRIHW-LKIQKSIRDIVYEAQL 223

  Fly   268 ASSTHPA 274
            .|.|..|
 Worm   224 ESVTKAA 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 10/88 (11%)
BESS 226..260 CDD:281011 3/34 (9%)
madf-10NP_492729.1 MADF 53..147 CDD:214738 19/135 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48150
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.