DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and madf-5

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans

Alignment Length:339 Identity:76/340 (22%)
Similarity:128/340 (38%) Gaps:100/340 (29%)


  Fly    16 AINAKICHLVKLHPCLYDRHDDNYLRKST-----VKNAWKEISNEMRNSVKSC-----KERWRNI 70
            |.||::.:.|:.:||||     |:.|:.:     .:..|:.|:   :|...:|     |:||..:
 Worm     6 AFNARLINEVRKYPCLY-----NHSRRGSGDTMERQRLWESIA---KNIDPNCAAEFAKKRWLQL 62

  Fly    71 RSSYARSIK--LHHGANT----YYLNSELK----FLQKHI------------------TPGVPVP 107
            |..|.:.:|  :.:|..|    .|.| :|.    ||:.:|                  ..|.|..
 Worm    63 RDRYRKELKIAIKNGFVTPVRWCYFN-QLSWLDPFLKDNIGQAADEGKKTGKSDSFDEPSGTPFS 126

  Fly   108 LRG--RRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQF--- 167
            ..|  ..:..|.:.|.|:.||... .::|:.      |.::.||...|..|....|...||.   
 Worm   127 WFGFPNLNSIKDEMEDDDSDPALE-SSVLDR------LLAQTAQRLDSISPEIENDESGTQSLDG 184

  Fly   168 ----------NNEPSSIMDFEDTV----PAEMRTESDSSE--KE---AKVGEITLYRVPLLEFPK 213
                      ..|...|.| ||.|    |.:::::|::..  ||   |:..:.|.....:.:..:
 Worm   185 NLDGVDGDGDEEEDLKIKD-EDEVEEDGPEKVKSQSEAMAMLKEAISAQSQQQTQQAQQVQQVQQ 248

  Fly   214 TSTR-CIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSA-SSTHPAQP 276
            |..: .:|:| |......|...|..::..|:            .:|.....||::| ....|:.|
 Worm   249 TPQKPSVESL-IAANQARFAHHLAAQLTGMS------------SMLNGARKSEEAAIPPLRPSTP 300

  Fly   277 HPRENVNGTLSTTS 290
            .|      |.||||
 Worm   301 PP------TASTTS 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 24/100 (24%)
BESS 226..260 CDD:281011 4/34 (12%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4064
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.