DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3919 and madf-2

Sequence 1:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans

Alignment Length:311 Identity:59/312 (19%)
Similarity:116/312 (37%) Gaps:94/312 (30%)


  Fly    11 PPNVYAINAKICHLVKLHPCLYDRH---DDNY--LRKSTVKNAWKEISNEMRNSVK-SCKE---R 66
            |.....|||     ::..|.::|::   :.||  |:.|.::....|:::..:..:| :|::   :
 Worm     7 PSRQCLINA-----IRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVRSQ 66

  Fly    67 WRNIRSSYARSIK-LHHGANTYYLNSELK-----------FLQ-----------KHITPGVPVPL 108
            |:|::.::.|.:: :|.|.   |:...:|           ||.           :|.....|   
 Worm    67 WKNLKDTFVRKLRWVHEGK---YMEDAMKEPTWKFYRMLTFLDEKEAKRLGDTCEHTYELAP--- 125

  Fly   109 RGRRSRPKGQEEHDEGDPETPVEAILEMVHS--------PSFLNS--------EHAQSRHSTDPA 157
               .|...||......:|.:..|.:.:|.::        .|.::|        |...:..||...
 Worm   126 ---NSTSCGQRAQISYEPTSTEEKMFQMFNNQPPPQLSQQSMIDSSQIATCSNEPKMTSSSTFVT 187

  Fly   158 SATDVE------ATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKVGEITLYRVPLLEFPKTST 216
            |:|.::      .|:..|..||.::.|    .|...|....:|..:.....:..:.::..|    
 Worm   188 SSTSLKRGVHYSPTRSPNGSSSGLEEE----LEDEDEQPGRKKSCRRQVSNIQPMQVITTP---- 244

  Fly   217 RCIEALPIMDFDD---------AFLQGLRPEIKHMNFHQKLYFKRRVYDLL 258
                  |:...|:         |.|:.:..|...||   .|..:||:||.|
 Worm   245 ------PVAHQDEFDHFGAMVAANLRRIANEQGRMN---ALRVQRRLYDAL 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 19/112 (17%)
BESS 226..260 CDD:281011 12/43 (28%)
madf-2NP_492896.1 MADF 11..107 CDD:214738 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48215
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.