| Sequence 1: | NP_001261839.1 | Gene: | stwl / 39581 | FlyBaseID: | FBgn0003459 | Length: | 1037 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070756.1 | Gene: | zgc:152938 / 768145 | ZFINID: | ZDB-GENE-061013-458 | Length: | 292 | Species: | Danio rerio |
| Alignment Length: | 221 | Identity: | 48/221 - (21%) |
|---|---|---|---|
| Similarity: | 94/221 - (42%) | Gaps: | 33/221 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD-ANR 74
Fly 75 RRNGQRRLAYPLADELRFL-----DRHLNIADDMAADD--DRSVSSDKDRDNNRDSEGVDHHAQA 132
Fly 133 SLKERASS-TSKLVKEVKLASQVRKEKSSQDKRENWEN----------------PGDKQRSRKKS 180
Fly 181 AEEKLNDLE----ESDEP---EKVPE 199 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| stwl | NP_001261839.1 | MADF | 11..98 | CDD:214738 | 20/92 (22%) |
| BESS | 604..637 | CDD:281011 | |||
| zgc:152938 | NP_001070756.1 | MADF_DNA_bdg | 60..128 | CDD:287510 | 17/67 (25%) |
| BESS | 226..260 | CDD:281011 | 6/33 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1634040at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001895 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||