DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and Adf1

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:197 Identity:42/197 - (21%)
Similarity:83/197 - (42%) Gaps:23/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNA 70
            :.:|.|:.:|:....:|||:..||:..:.....|..:|..:|...:||.:||:.||:.:.|....
  Fly    11 QFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKL 75

  Fly    71 DANRRRNGQRRLAYPLADELR-----FLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHA 130
            ....|....:::.: |.|.:|     .|.:..|     .:.....|:....:...:....||..|
  Fly    76 CQESRWRYFKQMQF-LVDSIRQYRESLLGKCAN-----GSQSANQVADPSQQQQAQQQTVVDIFA 134

  Fly   131 QASLKERASSTSKL--------VKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLND 187
            |.......:|...|        ..:.:||:.|.|::    |...:|.|..::||.::.::..||.
  Fly   135 QPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQ----KPYFYEPPLKRERSEEEHSDNMLNT 195

  Fly   188 LE 189
            ::
  Fly   196 IK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 22/91 (24%)
BESS 604..637 CDD:281011
Adf1NP_001260730.1 MADF 15..95 CDD:214738 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.