DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG11504

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster

Alignment Length:393 Identity:86/394 (22%)
Similarity:149/394 (38%) Gaps:88/394 (22%)


  Fly     1 MSAASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGES--VEKCKRRWRQLRND 63
            |....|..|.|:.....:..|:|.|.:.|||:...:...:.|:..:|.:  :.:.::::..||..
  Fly     1 MEWTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQ 65

  Fly    64 YTRWCNADANRRRN---------GQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDN 119
            |.|    :.:|.:.         |.:.|.: |:...........:..|:..|:.:.|..:...|:
  Fly    66 YHR----EISRMKRKEPYNSKWFGFKNLVF-LSSPYACRSTKGRLKADLQGDERKFVLGEVTADH 125

  Fly   120 NRDSEGVDHH---AQASLKE---RASSTSKLVKEV-KLASQVRKEKSSQDKRENWENPGDKQRSR 177
            |.||....:|   ..|::.|   |.:..|...:|: ||..:..|:....|:.|..|  |:.:..:
  Fly   126 NSDSSTPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEE--GEVKPKQ 188

  Fly   178 KKSAEEKLNDLEESDEPEKVPELDSFLQSDNEDDECMDEEHLED-LEGFDFDLEQSNQEKEL--- 238
            .|....:...|.|.:|.|.:         :|.....||..|..: :|...|   |:|:..||   
  Fly   189 AKEMSVRFVSLNEQEETEPL---------ENHHQTLMDLHHQGNAVEAVSF---QANESGELHYQ 241

  Fly   239 -TPEKSLEKNNTDSTVSQPEFFVK-QTRDPRLLIIGRKNS-------------TSSFAESKASKS 288
             ||.:|   ..:.|....|...:| |.||..   .|:::|             ...:.|:..:..
  Fly   242 TTPTQS---TGSSSVHVMPTRIIKIQRRDTS---SGQEDSYFEEHTQLHPPPVKRMYYEASPASH 300

  Fly   289 ISGDPLETAMEDSGDEYGRDGEKRVTGSD--TTSPTRRPRRAARASISFAGIRDLP----IQKPG 347
            .:...|..|:|.|.:.         |.|.  ||||          .|:.:.:| ||    ..||.
  Fly   301 NTTSILSPALESSANG---------TASSVLTTSP----------GITMSNLR-LPKVNTPPKPA 345

  Fly   348 QAQ 350
            |||
  Fly   346 QAQ 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 17/98 (17%)
BESS 604..637 CDD:281011
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 16/86 (19%)
CytochromB561_N 238..>409 CDD:286826 32/138 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.