DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and jigr1

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster

Alignment Length:317 Identity:59/318 (19%)
Similarity:106/318 (33%) Gaps:118/318 (37%)


  Fly     6 EVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNA 70
            |.:|.|:|.......||||:::.::.:|...:.|:.:|.::|......:.|...|||.|    |.
  Fly    28 EFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRY----NI 88

  Fly    71 DANRRRNG--QRRLAYPLADELRFLDRHL-------NIA-----------DDMAADDDRSVSSDK 115
            :..|..||  .:...:||.:.|:||..|:       |::           ||..:|.:..::|.|
  Fly    89 EKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIK 153

  Fly   116 DR--------D---------------NNRD---------------SEGVDHHAQASLKERASSTS 142
            |.        |               ||.|               .:|.:|.|: |...|..:..
  Fly   154 DELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAE-SYHRRHQNQP 217

  Fly   143 KLVKEVKLASQVRKEKSSQDKRENWENPGDK---------------------------------- 173
            :.:....:.:.:|..|......:  ::|..:                                  
  Fly   218 EYIISSPIVNPMRSNKRGSQHLD--DHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGEFM 280

  Fly   174 ----------------QRSRKKSAEEKLNDLEESDEPEKVPELDSFLQS--DNEDDE 212
                            |:..::..:..|.: |:|...||..|:|...||  ..|:||
  Fly   281 CHSLCDMPAATALRLVQKFTRELVQSSLRN-EDSGSKEKTDEVDPVDQSSESQEEDE 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 25/96 (26%)
BESS 604..637 CDD:281011
jigr1NP_001097920.1 MADF 33..118 CDD:214738 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.