DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG6276

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:645 Identity:103/646 (16%)
Similarity:200/646 (31%) Gaps:227/646 (35%)


  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQL----RNDYTRWCNAD 71
            |:..|::..|:|:...:.|..|...||.|..|..::.::......:|..|    |.:||.:....
  Fly    33 LIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISFRREYTNYLEEK 97

  Fly    72 ANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKE 136
            ...        .:...|.:.||..:|                   |..::..:.:|...|.:|..
  Fly    98 VPP--------CWSYFDRMFFLHPYL-------------------RKKHQQPKSLDTQVQDALAH 135

  Fly   137 RASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPEKVPELD 201
            .::.:|::.:|..:..........|......::|         .|::..|.|:..||.|      
  Fly   136 LSNLSSRMQRERSVTIPGSSSIGGQPTPSAHQSP---------PAQQLDNYLDYFDEAE------ 185

  Fly   202 SFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKELTPEKSLEKNNTDSTVSQP-EFFVKQTRD 265
               .:::|.|:.|:||                |::.......|:.|:..|...:| :.:.::..:
  Fly   186 ---HNNSELDDIMEEE----------------QQRNSRYHGQLDGNDIKSECEEPVDDYEQEAHE 231

  Fly   266 PRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDTTSPTRRPRRAAR 330
            |.                               ||..|:  :|..|....|.::|...:.|.|.:
  Fly   232 PE-------------------------------EDEQDD--QDLHKMAPTSSSSSAEAQRRYANQ 263

  Fly   331 ASISFAGIRDLPIQKPGQAQRMT--RLQRRKSMSLAAVHSVRSSTSPVKMTPVPRSQPINKPPSG 393
            .|               .|.||.  |||            :|:....::....||||.:..|   
  Fly   264 HS---------------HASRMLPGRLQ------------MRTYHDEMRGAIRPRSQELQAP--- 298

  Fly   394 PVQITKISHRDDIFPRPAVPSGVVNINQNQLKTQQQQKTLIFPTTDEAI---------ANPQGSG 449
                               .:.|..:|.:...|.....:.:.||..:.:         ....|.|
  Fly   299 -------------------TAAVAGVNYSAQPTAHPNISFVRPTFSKPVDLVSTTTHAGGGGGGG 344

  Fly   450 PPQRRSVGRPPKKLPMVQRIVAPETQTKPQSPINTKVLTIGKPTSSVASGNINNIAIKSNVVTSI 514
            .|  .:.|....:||               :|....|.|...|:|||                  
  Fly   345 VP--GTAGLSEAELP---------------TPSTAAVATPMAPSSSV------------------ 374

  Fly   515 SSSTATTNTITKGTSNNSIKTTENVNVISYSPNSSSTSSSSKATTGASGAVITNIPTTTTAGTSV 579
             |::::::.:::...:|.:.........|..|.....:::|..:....||.:.:..|        
  Fly   375 -SASSSSSYLSQRHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKT-------- 430

  Fly   580 PVGKSITQLKMTERGTQTGVQNPFSDNYFLEMIKPQMQEMNPRQKMHFKKKVFQALMETF 639
                                 :|  |..||..:.|.:|::|.|.:... |..||.:::.:
  Fly   431 ---------------------DP--DAMFLMSLLPDIQKLNGRDRGKI-KIAFQNILQDY 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 19/91 (21%)
BESS 604..637 CDD:281011 10/33 (30%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/110 (17%)
BESS 431..465 CDD:281011 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.