DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and hng2

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:108/270 - (40%) Gaps:76/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAASEVNLML---LRSVEKQTALYDRTDENYRKRLPSENAWDMVASEV------------GESVE 51
            ||.|.:...:   :.:|.|::.:::|:..|:..|...:.||..:..|:            .|.|:
  Fly     9 SAGSNLRYSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVK 73

  Fly    52 KCKRRWRQLRNDYTRWCNADANR-RRNGQR--RLAYPLADELRFLDRHLNIADDMAADDDRSVSS 113
            ...:||:..|:.|.|     .|| |::|:.  |.:|....||.||   ||:..:  ::||     
  Fly    74 TLLKRWKNTRDSYLR-----VNRLRQSGEEVARASYIYEKELSFL---LNVKAE--SEDD----- 123

  Fly   114 DKDRDNNRDSEGVDHHAQASLKERASSTSKLVKEVKLASQ---VRKEKSSQDKRENWENPGDKQR 175
                             ..||||:....:|. |.|..|:|   ....|.:.|:..|.| |..:..
  Fly   124 -----------------VESLKEQPKPQAKR-KRVSTAAQRSAKTPRKRNSDQESNIE-PAIRNP 169

  Fly   176 SRKKSAEEKLNDL----EESDEPE--KVPELDS---------FLQSDNEDDECMD--EEHLEDL- 222
            :...:....|.||    |::..||  .:|:|.|         :|.:| .|....|  :.|::.: 
  Fly   170 AIPSNINTVLGDLGCAKEDTATPEIAYIPQLPSDPPCSTNTAYLSAD-PDQAFFDTIKPHMQQMC 233

  Fly   223 --EGFDFDLE 230
              ...||.:|
  Fly   234 ADRKLDFQIE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 25/104 (24%)
BESS 604..637 CDD:281011
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 23/96 (24%)
BESS 216..250 CDD:281011 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.