DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and Mes2

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster

Alignment Length:345 Identity:63/346 (18%)
Similarity:109/346 (32%) Gaps:124/346 (36%)


  Fly     9 LMLLRSVEKQTALYDRTDENYRKRLPSEN-AWDMVASEVGESVEKCKRRWRQLRNDYTR------ 66
            |.|::.|.....|:|....|::.....:| ||:.:..|......:..|.::.||..|.|      
  Fly    61 LKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVK 125

  Fly    67 ---------W--------------------------------CNADANRRRNGQRRLAYPLADEL 90
                     |                                .|.:.|...|.....|...|..|
  Fly   126 LMGNGFKPKWSLYEAMDFLRDVIRERKGASHATDLSLTTYGHINNNNNNNNNSNSLAAGGKAMTL 190

  Fly    91 RFLD--------------RHLNIADD-------MAADDDRSVSSDKDRDNNRDSEG-----VDHH 129
            :..:              ..||::||       :..:.|.||........:..|.|     :..|
  Fly   191 KLSNSFNESASVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGGAGSSTSGSSSGGGPLPLPAH 255

  Fly   130 AQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEP 194
             ||....|.|||             |.|:.:|  ..::|:..|   |..:|.:|.:  ...||..
  Fly   256 -QAHNDSRVSST-------------RNEQRAQ--HHSYEDMDD---SSIRSGDEDI--AHASDVV 299

  Fly   195 EKVPELDS------FLQSDNE-------DDECM--------DEEHLED--------LEGFDFDLE 230
            |::..:|:      .|.|::.       ||..|        |::.||:        ::|.|::.:
  Fly   300 EELDAIDADFPYPLILDSNSRGSPNVGVDDVVMSRKLRRNVDQDVLEEGNGHGDAVIDGDDYEEQ 364

  Fly   231 QSNQEKELTPEKSLEKNNTD 250
            ...|.:.|..::.:.....|
  Fly   365 MLQQHRHLRQQQGVASGGLD 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 22/149 (15%)
BESS 604..637 CDD:281011
Mes2NP_730768.1 MADF 62..149 CDD:214738 15/87 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.