DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG12768

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster

Alignment Length:296 Identity:65/297 (22%)
Similarity:102/297 (34%) Gaps:89/297 (30%)


  Fly   236 KELTPE-KSLEKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAME 299
            ||:..| ||.|:....|..|.|            :..|..|:.::.....:|.:.|.   ..|: 
  Fly    96 KEVIRERKSRERIKHGSLDSAP------------VATGSSNNNNNCVSRNSSNNNSS---SAAL- 144

  Fly   300 DSGDEYGRDGEKRVTGSDTTSPTRRPRRAAR---------ASISFAGIRDLPIQKPGQAQRMTRL 355
               |||     :....||..:|..:|:....         .|:|.. :..||:....|||.:..|
  Fly   145 ---DEY-----QYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLT-LSQLPVALQQQAQHLQAL 200

  Fly   356 QRRKSMSLAAVHSVRSSTSPVKMTPVPRSQPINKPPSGPVQITKISHRDDIFP------RPAVPS 414
            |.:..::|.::......||....||.|.:|      :.|.|:...|......|      .|..|:
  Fly   201 QLQPDVTLTSLQKQSLPTSLTNATPAPLAQ------TSPAQVLSSSRSCSSSPSIYIKDEPCSPA 259

  Fly   415 GVVNINQNQLKTQQQQKTLIFPTTDEAIANPQGSGPPQRRSVGRPPKKLPMVQRIVAPETQTKPQ 479
            |                    ...:|.:.   |:||...|      |||..::      .|||.|
  Fly   260 G--------------------GCPEEVMT---GNGPEATR------KKLATIR------PQTKQQ 289

  Fly   480 SPINTKVLTIGKPTSSVASG------NINNIAIKSN 509
            .....::.| .|.:||.|:.      |.||..|.::
  Fly   290 LKARLQLPT-PKNSSSYATSPPHLIINANNELIDTD 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738
BESS 604..637 CDD:281011
CG12768NP_001262229.1 MADF 12..100 CDD:214738 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.