DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG8765

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster

Alignment Length:382 Identity:75/383 (20%)
Similarity:154/383 (40%) Gaps:77/383 (20%)


  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTR-------WC 68
            |:..::::..:|:..:||||........|:.:|.::.:||::|:.:|:.||:.|.|       ..
  Fly   319 LITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKRLRTLM 383

  Fly    69 NADANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQAS 133
            :.||..|        :...:.|.||.:::. ...:.:|...|:...|: |..|:.|  ||..|:.
  Fly   384 HIDATSR--------WKHYNSLSFLQKYIQ-QKTLESDSQLSMLLPKN-DPVRELE--DHMTQSH 436

  Fly   134 -------LKERASSTSKL-VKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDL-- 188
                   ..|.:||.|:| :..:...:...|.:..|.:::..|....:|:.:::..:::.::|  
  Fly   437 SPPTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQQQQEEQHQQQQQHQQQQQQQQASELCV 501

  Fly   189 ---EESDEPEKVPELDSFLQSD--NEDDECMDEEHLE--------------DLEGFDFDLE---- 230
               ::.|       :::::..|  :.||:..|:|..|              |.....:|.|    
  Fly   502 ATYDDMD-------IENYINGDVHHNDDDVEDDEDEEMETTTAAEQPPQQQDQHVMTYDHEDGPV 559

  Fly   231 ----------QSNQEKELTPEKSLEKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAESKA 285
                      .|.||:......|||.....||....:..::....||........|::|.:...:
  Fly   560 YMAVPSVGSAMSKQEQLSDGATSLENQQLQSTAEFQKIEIQTPTTPRYQNAATTPSSTSTSRYHS 624

  Fly   286 SKSISGDPLETAME---DSGDEYGRDGEKRVTGSDTTSPTRRPRRAARASISFAGIR 339
            :......|  |.||   .:|...|.|.|   .|:...:.:.:.|.|....::|..::
  Fly   625 APITPSKP--THMEYPSSNGHNSGEDDE---IGAFFKAVSMKIRNAQLEPVAFTELQ 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 22/94 (23%)
BESS 604..637 CDD:281011
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.