DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG3919

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster

Alignment Length:334 Identity:73/335 (22%)
Similarity:132/335 (39%) Gaps:83/335 (25%)


  Fly     7 VNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD 71
            :|..:...|:....||||.|:||.::...:|||..:::|:..||:.||.|||.:|:.|.|     
  Fly    17 INAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYAR----- 76

  Fly    72 ANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGV---------- 126
            :.:..:|..  .|.|..||:||.:|:.....:.....||....::..:..|.|..          
  Fly    77 SIKLHHGAN--TYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHS 139

  Fly   127 -----DHHAQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLN 186
                 ..|||:    |.|:......:|: |:|...|.||....|:            ....|...
  Fly   140 PSFLNSEHAQS----RHSTDPASATDVE-ATQFNNEPSSIMDFED------------TVPAEMRT 187

  Fly   187 DLEESDEPEKVPELDSF----LQSDNEDDECMDEEHLED-----LEGFDFDLEQSNQEKELTPEK 242
            :.:.|::..||.|:..:    |:.......|::...:.|     |:|...:::..|..::|..::
  Fly   188 ESDSSEKEAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKR 252

  Fly   243 SL----------EKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAE--------------- 282
            .:          |::.:.:..:||.        ||..:.|..::|||.:.               
  Fly   253 RVYDLLGEIFHSEQSASSTHPAQPH--------PRENVNGTLSTTSSLSSANPLQHMGLMLQLPK 309

  Fly   283 --SKASKSI 289
              |||||.:
  Fly   310 LVSKASKDL 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 30/87 (34%)
BESS 604..637 CDD:281011
CG3919NP_001261840.1 MADF 20..100 CDD:214738 30/87 (34%)
BESS 226..260 CDD:281011 5/34 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.