DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG6163

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster

Alignment Length:419 Identity:76/420 (18%)
Similarity:135/420 (32%) Gaps:128/420 (30%)


  Fly   341 LPIQKP--GQAQRMTRLQRRKSM--SLAAVHSVRSSTSPVKMTPVPRSQPINKPPSGPVQITKIS 401
            :|.:.|  .:||.:..:::...:  |...:|..||.|||:       ...|.:...|.|...|:.
  Fly     1 MPKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPM-------WTEIAEQFGGHVPTVKLQ 58

  Fly   402 --------HRDDIFPRPAVPSGVVNINQNQLKTQQQQ---KTLIFPTTDEAIANPQGSG------ 449
                    |..::..|..       :::::..|:.:.   .:.::..|...|...|.||      
  Fly    59 SIWSQMKYHYHNLVHRQI-------LHKDRFNTKWEHFEPMSFMYNITVAKIVGAQSSGGSGGGT 116

  Fly   450 ---------------------------PPQRRSVGRPPKKLPMVQRIVAPETQTKPQSP------ 481
                                       |......|||......:|....|   |.||.|      
  Fly   117 SSDAPSTATEAATVGEEPAAPVAPPPLPTATHGRGRPSGSFSWLQTATTP---TAPQLPHLITQP 178

  Fly   482 --------INTKVLTIGKPTSSVASGNINNIAIKSNVVTSISSSTATTNTITKGTSNNSIKTTEN 538
                    ..|....:..|.::|||..:.....|....:|:.:|       .:|...::|||..:
  Fly   179 PHSQGHGMTYTAFTGLVPPPATVASETVATPPRKLGRPSSLHNS-------MRGRIIDAIKTRPS 236

  Fly   539 VNVISYSPNSSSTSSSSKATTGA---SGAVITNI-PTTTTAGTSVPVGKSITQLKMTERGTQTGV 599
            :    ::....|.....::.|.|   ..|:...: ||......|:...:.:.:|: .||..|...
  Fly   237 L----WAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQ-KERHAQYSH 296

  Fly   600 QN------PFSDNYFL-----------EMIKPQMQEMNPRQKMHFKKKVFQALMETFDDATDFPT 647
            |:      .|....|:           |..:.|:||:...|:.|              ..|....
  Fly   297 QSFRSTWEHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQHH--------------QQTQHHP 347

  Fly   648 SKELQHFN-INTPSGF-EHITDPELRLVR 674
            |:.|.|:. ...|:|. ||..|..:.||:
  Fly   348 SQHLHHYRPPQPPAGLVEHAQDMPIGLVQ 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738
BESS 604..637 CDD:281011 7/44 (16%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738 15/100 (15%)
MADF 226..316 CDD:214738 17/95 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.