DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG6683

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster

Alignment Length:226 Identity:43/227 (19%)
Similarity:61/227 (27%) Gaps:111/227 (49%)


  Fly     5 SEVNLMLLRSVEKQTALYDRTDEN-----YRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDY 64
            |:.:..|:..|.....||:|...|     ::||.|  ..|..:|:.:......|..||..|    
  Fly     2 SQFDTRLIELVRANPKLYERELRNAPYEAHKKRHP--EIWSSIATSLNSEASACVSRWNHL---- 60

  Fly    65 TRWCNADANRRRNGQRRLA------YPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDS 123
                  .|.:||...:..|      :.|...|:||..|                           
  Fly    61 ------VAKQRRELAKEKAGGTGSDWSLLPHLKFLQHH--------------------------- 92

  Fly   124 EGVDHHAQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDL 188
                ||.                                  .|..|.||..||..||::|     
  Fly    93 ----HHP----------------------------------INHRNSGDLSRSTLKSSDE----- 114

  Fly   189 EESDEPEKVPELDSFLQSDNED--DECMDEE 217
                            .:|:||  .|.|||:
  Fly   115 ----------------VNDDEDPLQEAMDEQ 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 24/98 (24%)
BESS 604..637 CDD:281011
CG6683NP_648232.1 MADF 7..94 CDD:214738 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.