DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and hng1

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster

Alignment Length:292 Identity:62/293 (21%)
Similarity:111/293 (38%) Gaps:70/293 (24%)


  Fly     8 NLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADA 72
            :::|::::.:..:|||....::|.....|..|..||..:..|:...:|||..||:.|:|...   
  Fly    12 DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELK--- 73

  Fly    73 NRRRNGQRRLAYPLADELRFLD--RHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLK 135
                  |:|| :| :.|....|  |.::...|...  .|.....::||..:...|   ..:..|:
  Fly    74 ------QKRL-HP-SGEFGHNDFFRKMDFLRDFVR--KRRERRGRERDREQKPTG---WMKVDLQ 125

  Fly   136 ERASS-----TSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAE--EKLNDLEESDE 193
            .|..:     |..|::|        :...:.|:.|...:...|..|....:|  ..:.:.::..|
  Fly   126 RRRRTRLPIDTETLIEE--------QGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQE 182

  Fly   194 PEKVPELDSFLQSDNEDDECMDEEHL----------------EDLEGFDFDLE-------QSNQE 235
            ||: ...|.||    .|.||..:..:                |.:|....||.       .:|||
  Fly   183 PEQ-ESFDEFL----GDAECEQKVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVCMPPNANQE 242

  Fly   236 KELTPEKSLEKNNTDSTVSQ------PEFFVK 261
            :|   ..:.|..|..:.::|      .:||.|
  Fly   243 RE---HSAPELPNPTAVITQKTCETEDDFFCK 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 24/89 (27%)
BESS 604..637 CDD:281011
hng1NP_611558.2 MADF 15..98 CDD:214738 25/94 (27%)
BESS 264..298 CDD:281011 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.