DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG7745

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster

Alignment Length:688 Identity:122/689 (18%)
Similarity:223/689 (32%) Gaps:244/689 (35%)


  Fly    11 LLRSVEKQTALYDRT------DENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCN 69
            |:..|.:...:|:|.      ..|..|....:.||.::|.::...|:.||:||:.||..|     
  Fly     6 LIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERY----- 65

  Fly    70 ADANRRRNGQ----RRLAYPLADELRFLDRHLN-----------IADDMAADDDRSVSSDKDRDN 119
              .::|:.|.    ..|:.|..::::|||:|:.           :....:|:.........|:.|
  Fly    66 --VSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSN 128

  Fly   120 NR-------DSEGVDH--------HAQASLKERASSTSKLVK-EVKL-ASQVRKEKSSQDKRENW 167
            ..       .|.|..|        ||.::|...|:|..:.|. :||: |.||.::.::       
  Fly   129 GSMKNVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAA------- 186

  Fly   168 ENPGDKQRSRKKSAEEKLNDLEESDEPEKVPELDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQS 232
                       ..|.::|..:.:|...::...:.:.:.                      |..|.
  Fly   187 -----------AVASQQLQHISQSQMQQQAAAVAAVMA----------------------DSSQG 218

  Fly   233 NQEKELTPEKSLEKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAESKAS-KSISGDPLET 296
            .|:                          |.:|..:.:.|.:||..|...:.:| ||....||:.
  Fly   219 YQD--------------------------QYKDGSVGMNGAQNSAGSLTSTSSSMKSPLSSPLQG 257

  Fly   297 AMEDSGDEYGRDGEKRVTGSDTTSPTRRPRRAARASISFAGIRDLPIQKPGQAQRMTRLQRRKSM 361
                             .|:.:..|.::.::..:             |:..|||:.:....::  
  Fly   258 -----------------IGAGSHHPQQQTQQQQQ-------------QQQQQAQQQSPASEQQ-- 290

  Fly   362 SLAAVHSVRSST-------SPVKMTPVPRSQPINKPPSGPVQITKISHRDDIFPRPAVPSGVVNI 419
             |..|||..|:|       |.::|    :...:..|....:..:..||.....||       :.:
  Fly   291 -LPVVHSSSSATGASIGNSSTLQM----QQSHVYNPKGDGLDSSSSSHFHMKKPR-------IQL 343

  Fly   420 NQNQLKTQQQQKTLIF--PTTDEAIANPQGSGPPQRRSVGRPPKKLPMVQRIVAPETQTKPQSPI 482
            |.| ...|.......|  .:.||:..|......||           .|:|:    |.......|:
  Fly   344 NGN-AHNQMTSNGSHFGNDSDDESDENSHDLMEPQ-----------AMMQQ----ENHYSNSMPM 392

  Fly   483 NTKVLTIGKPTSSVASGNINNIAIKSNVVTSISSSTATTNTITKGTSNNSIKTTENVNVIS---- 543
            ..            .:||.||           |||.:.:|..:...|:|:.:..::.|:..    
  Fly   393 QR------------GNGNGNN-----------SSSNSGSNNPSGNNSHNNQQQQQHQNMFPSNTD 434

  Fly   544 -----YSPNSSSTSSSSKATTGASGAVITNIPTTTTAGTSVPVGKSITQLKMTERGTQTGVQNPF 603
                 |.......|||..|..|                            |........|||. .
  Fly   435 FLFQLYQQFPHQASSSHPANFG----------------------------KFQAPPNHPGVQR-L 470

  Fly   604 SDNYFLEMIKPQMQEMNPRQKMHFKKKVFQALMETFDD 641
            |::...|::..::.:||..:|...:|::.:.|.  |||
  Fly   471 SEHLLGELVTTELLKMNKERKKSAQKRILEILF--FDD 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 25/97 (26%)
BESS 604..637 CDD:281011 7/33 (21%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.