DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG10949

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster

Alignment Length:378 Identity:78/379 (21%)
Similarity:124/379 (33%) Gaps:128/379 (34%)


  Fly     7 VNLMLLRSVEKQTALYDRTDENYRKRLPSEN-AWDMVASEVGESVEKCKRRWRQLRNDYTRWCNA 70
            :|..|:..|:....||||......|.|.::| ||..::..:..|.|.|..||::||:.:.|    
  Fly   137 LNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGR---- 197

  Fly    71 DANRRRNGQRRLAYPLA----DELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQ 131
               ..|:.|...:.|:.    ::|.||.||..                                 
  Fly   198 ---EFRSHQINQSTPITWRYFNDLLFLGRHFR--------------------------------- 226

  Fly   132 ASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEP-- 194
                          |.|.|..:..|.:....|.   .||..|                .|.:|  
  Fly   227 --------------KGVPLVLENIKRRGRPPKA---GNPSGK----------------TSKQPEG 258

  Fly   195 ------EKVPELDSFLQSDNEDDE-----CMDEE-----HLEDLEGFDFDLEQSNQEKELTPEKS 243
                  |::...|....:||:|.|     ..|||     ..|....:||.|.::...::|.|.:.
  Fly   259 MVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQ 323

  Fly   244 LEKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAESKASKSISGDPL-------ETAMEDS 301
            |:...|....|:.........:|.:     :.|:|...:|..|.:||...|       ||.::.|
  Fly   324 LQVTTTTPATSEEIIHTIARVNPVV-----EESSSLPGDSVPSAAISDKLLTTVIANMETVLQQS 383

  Fly   302 GD-------EYGRDGEKRVTGS------------DTTSPTRRPRRAARASISF 335
            .:       |..::.|:|.|..            |..||:.| ..|.|..:.|
  Fly   384 RELQAQIHHEQEQEREQRSTQPANSLLAKAQMLLDGLSPSER-ASAERKIVQF 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 27/92 (29%)
BESS 604..637 CDD:281011
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 27/93 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.