DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and brwl

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster

Alignment Length:496 Identity:106/497 (21%)
Similarity:167/497 (34%) Gaps:146/497 (29%)


  Fly     1 MSAASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYT 65
            |.|..:.|:..:..|.....|||:....||.|...|.||.:::.|..|||..||.|||.||...:
  Fly    51 MQADEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLS 115

  Fly    66 RWCNADANRRRNGQ--RRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDH 128
            |:.     ::::|.  :...|.|.:.:.||...|.             ||....:.|.....:..
  Fly   116 RYI-----KQQSGSEPQHKPYYLTEHMAFLLPFLK-------------SSRNSLEGNNSLATLYQ 162

  Fly   129 HAQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDE 193
            .:|..|:.:..    |:.....|::..|..::.....|..|                ||:...:.
  Fly   163 MSQQHLQHQPF----LLHPALHATEEHKYCANTSINNNNNN----------------NDVHNGES 207

  Fly   194 PEKVPELDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKELTPEKSLEKNNTDSTVSQPEF 258
            .| |.|: .:..|:.:|:|.:|.          ||...:|         :|..|.|.||      
  Fly   208 ME-VLEM-KYSISEKDDEETIDA----------FDPAVTN---------TLGMNRTSST------ 245

  Fly   259 FVKQTRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSD------ 317
               .||...|...|..:...|               :||..||...:..|.:...|||.      
  Fly   246 ---PTRSSALQGGGGNSPARS---------------DTASADSMKNFIPDVQLAETGSQLIYSDG 292

  Fly   318 ---TTSPTRRPRRAARASISFAGIRDLPIQKPGQAQRM-TRLQRRKSMSLA-AVHSVRSSTSPVK 377
               |..|......:....::.:........:||..:|: |..:...:|:.| :::...||:....
  Fly   293 GHGTPPPLHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSSSEVAD 357

  Fly   378 M-------------TPVPRSQPINKPPSGPVQITKISHRDDIFPR-PAVP-------SGVVNINQ 421
            |             ||..|    .|...|.:::.     ||:..| ||..       |||||   
  Fly   358 MEFFRSILPDLATLTPQQR----RKFKIGILELI-----DDVVTRYPAQDHSNGGGVSGVVN--- 410

  Fly   422 NQLKTQQQQKTLIFPTTDEAIANPQGSGPPQRRSVGRPPKK 462
                             ....::..||...||||.||..:|
  Fly   411 -----------------GSGGSSNGGSVKHQRRSSGRDWRK 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 28/89 (31%)
BESS 604..637 CDD:281011
brwlNP_609298.1 MADF 60..145 CDD:214738 28/90 (31%)
BESS 356..389 CDD:281011 7/42 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.