DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG11723

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster

Alignment Length:361 Identity:73/362 (20%)
Similarity:130/362 (36%) Gaps:98/362 (27%)


  Fly     8 NLMLLRSVEKQTALYD-RTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD 71
            |..|::.|.|:..|:| ....:||.: .:...|..||..:.:.|..||:|::.:|:.|.      
  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQ-DAALQWASVAQIMQQDVSICKKRFKGMRDSYR------ 62

  Fly    72 ANRRRNGQRRLA---YPLADELRFL-----------------------------DRHLNIADDMA 104
            |..|:..|:|:.   :|....|.|:                             .|.::.|.|:.
  Fly    63 AEVRKIQQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLD 127

  Fly   105 ADDDRSVSSDKDRDNNRDSEGVDHHAQASLKERASSTSKLVKEVKLASQVRKEKSSQD------- 162
            .|:|.||..:...|..:....|.       ::..|....|:|.:. :|.....:|.||       
  Fly   128 LDNDDSVDFEIIEDIFKREPSVP-------QDSGSDKGSLIKPLD-SSSSGAHRSDQDLSPTLPI 184

  Fly   163 ---KRENW---ENPGDKQRSRKKSAEEKLNDL-----------EESDEPEKVPELD-SFLQSDNE 209
               :.:.:   ..|..|:..|:|::..  ||:           :.:.||:...:.| |||.|   
  Fly   185 HLPRHQQFLPRPPPPSKRGRRRKTSPS--NDVPLLNGYASQASKSTTEPDLKNDSDLSFLMS--- 244

  Fly   210 DDECMDE-EHLEDLEGFDFDLEQSNQEKELT-----------PEKSLEKNNTDSTVSQPEFFVKQ 262
               .|.. :.|..:....|.:|.:....||.           ||..||::....|.:....|..|
  Fly   245 ---MMPHVKSLSAISNLKFRMEMARVLVELREEDQHMLAAAGPEDVLERSMPKLTPAPNSSFATQ 306

  Fly   263 TRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAM 298
            ....:..:     |.||:..|......|.|.::::|
  Fly   307 LEKSQYHL-----SNSSYQISSRKTPTSFDYVDSSM 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 24/120 (20%)
BESS 604..637 CDD:281011
CG11723NP_001259906.1 MADF 7..91 CDD:214738 23/91 (25%)
BESS 236..270 CDD:281011 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.