DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG8119

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster

Alignment Length:56 Identity:21/57 (37%)
Similarity:37/57 (65%) Gaps:4/57 (7%)


  Fly    11 LLRSVEKQTALYD-RTDENYRK-RLPSENAWDMVASEVGESVEKCKRRWRQLRNDY 64
            |||.:..:.:::| |...:.|: ::|.:  |..|::.||..|::|||||:.|||:|
  Fly    18 LLREIALRPSIWDSRIKFSLRRPQIPID--WLDVSNAVGLGVDECKRRWKSLRNNY 71

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 21/57 (37%)
BESS 604..637 CDD:281011
CG8119NP_573050.1 MADF 17..97 CDD:214738 21/57 (37%)
BESS 201..234 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.