DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stwl and CG4404

Sequence 1:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster

Alignment Length:332 Identity:74/333 (22%)
Similarity:121/333 (36%) Gaps:91/333 (27%)


  Fly     8 NLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADA 72
            |:..::.||.|..|::.|...|.|:...:.||..||:::.::|..|:.|||.:|:.:.|  :...
  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLR--SLKL 77

  Fly    73 NRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKER 137
            .|.:.|:.:..|.|:..|:||                 |...|.|..::...|:     ...|..
  Fly    78 ARTQTGRGKRKYYLSKYLQFL-----------------VPFTKSRSCHKQLPGM-----VLRKPG 120

  Fly   138 ASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPEKVPELDS 202
            .::|::...||..|.:       :.|..:.|.|.|.|.|     ||:....:|.|..:....|..
  Fly   121 QAATAQQEDEVVAAEE-------EAKVSDGEMPLDVQVS-----EEEHRRNQEQDREQPTACLPL 173

  Fly   203 FLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKE-LTPEKSLEKNNTDSTVSQPEFFVKQTRDP 266
            .|.|       :..||         |...:||:.| :..::||        ||.|...:...   
  Fly   174 RLHS-------IKVEH---------DSSNANQQLERMVSQQSL--------VSVPAAALGNH--- 211

  Fly   267 RLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDT-TSPTRRPRRAAR 330
                :|..:.|..|                      ..:|....|..|.:.| |||...|:.|..
  Fly   212 ----LGWSDLTQWF----------------------KGHGSGHHKLTTTTTTPTSPPPPPQPATS 250

  Fly   331 ASISFAG 337
            |...|.|
  Fly   251 ALSVFTG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 25/87 (29%)
BESS 604..637 CDD:281011
CG4404NP_572838.2 MADF 17..103 CDD:214738 26/105 (25%)
BESS 267..301 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.